KEGG   Sinorhizobium medicae: Smed_4144Help
Entry
Smed_4144         CDS       T00555                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
smd  Sinorhizobium medicae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Smed_4144
  Lipid metabolism
   00561 Glycerolipid metabolism
    Smed_4144
   00600 Sphingolipid metabolism
    Smed_4144
Enzymes [BR:smd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Smed_4144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p1: 
UniProt: 
Position
pSMED01:616757..618130
Genome map
AA seq 457 aa AA seqDB search
MTRQPRITFIGAGSTVFMKNIIGDILQRPALSAATIALMDVNPERLAESEIVAGKLARTL
GAGARIETHSDQRKALTGADFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDMLEVCPEAILLQYVNPMAINTWAIAERYPAIKQVGLCHSVQGTA
YELARDLEIPLEEIRYRAAGINHMAFYLKFEHRQKDGSYRDLYPDLIRGYREGRFPKPSH
WNPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKEGRPDLIEKFGIPLDEYPKRCIE
QIERWKGQAAAFKEAETMEVAESREYASSIMNSVWTGEPSVIYGNLRNNGCITSLPENCA
AEMPCLVDQSGIQPTHIGALPPQLTALIRTNINVQELTVQALVTENREHLYHAAMMDPHT
AAELDLDQIWSLVDDLLTAHRDWIPEWARVAQKVAAA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgagacaacccaggatcactttcatcggcgccggttccaccgtgttcatgaagaac
attatcggcgatatcttgcagcgcccggcgctttcggccgcgaccatcgccttgatggac
gtcaacccggagcgcctggcggaaagcgagatcgtcgcgggcaagctggcgcgcacgctg
ggcgccggcgccaggatcgagacgcactccgaccagcgcaaggcgctcacgggagcggac
ttcgtcgtggttgccttccagatcggcggctacgagccatgcaccgtgacagatttcgag
gtgccgaaaaaatacggactgcgccagacgatcgccgacacgctcggcgtcggcggcatc
atgcgggggttgcgcaccgtcccgcatctctggaagatctgcgaggacatgctcgaggtc
tgccccgaggcgatcctcctgcaatatgtaaacccgatggcgatcaacacctgggcgatc
gccgagaggtatccggccatcaagcaggtgggcctctgccactccgtgcagggcacggcc
tatgaactcgcccgcgatctcgagataccgctcgaggagatccgctatcgcgccgccggc
atcaaccacatggccttctatctgaaattcgagcaccgtcagaaggacggcagctatcgt
gatctctatccggaccttatccgcggctaccgcgaggggcgctttccgaagccgagccat
tggaacccgcgctgcccaaacaaggtacgttacgaaatgctgacgcggctcggctatttc
gtcaccgaaagctcggagcatttcgccgagtacacgccctatttcatcaaggaggggcgt
cccgatctgatcgaaaaattcgggattccgctcgacgagtatccgaagcgttgcatcgag
cagatcgagcgctggaagggccaggcggccgccttcaaggaggcggagacgatggaagtc
gcagagagccgcgaatatgcctcctcgatcatgaactcggtctggaccggcgagccctcg
gtgatttacggcaacctcagaaacaatggctgcatcacctcgctgccggaaaactgcgcg
gcggagatgccgtgtctcgtcgatcagtcgggtattcagccgacccatatcggcgcgctg
ccgccgcaactcacggcgttgatccgcaccaacatcaacgtacaggagttgacggttcag
gcgctcgtcactgaaaaccgggagcatctctaccatgcggcaatgatggatccgcatacc
gccgccgagctcgacctcgaccagatctggtcccttgtcgacgatctgctcacagcgcac
cgcgactggatcccggaatgggcccgcgtcgcgcagaaggtagcggccgcctga

DBGET integrated database retrieval system