KEGG   Sinorhizobium medicae: Smed_4144Help
Entry
Smed_4144         CDS       T00555                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
smd  Sinorhizobium medicae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smd00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:smd00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:smd00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p1: 
UniProt: 
Position
pSMED01:616757..618130
Genome map
AA seq 457 aa AA seqDB search
MTRQPRITFIGAGSTVFMKNIIGDILQRPALSAATIALMDVNPERLAESEIVAGKLARTL
GAGARIETHSDQRKALTGADFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDMLEVCPEAILLQYVNPMAINTWAIAERYPAIKQVGLCHSVQGTA
YELARDLEIPLEEIRYRAAGINHMAFYLKFEHRQKDGSYRDLYPDLIRGYREGRFPKPSH
WNPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKEGRPDLIEKFGIPLDEYPKRCIE
QIERWKGQAAAFKEAETMEVAESREYASSIMNSVWTGEPSVIYGNLRNNGCITSLPENCA
AEMPCLVDQSGIQPTHIGALPPQLTALIRTNINVQELTVQALVTENREHLYHAAMMDPHT
AAELDLDQIWSLVDDLLTAHRDWIPEWARVAQKVAAA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgagacaacccaggatcactttcatcggcgccggttccaccgtgttcatgaagaac
attatcggcgatatcttgcagcgcccggcgctttcggccgcgaccatcgccttgatggac
gtcaacccggagcgcctggcggaaagcgagatcgtcgcgggcaagctggcgcgcacgctg
ggcgccggcgccaggatcgagacgcactccgaccagcgcaaggcgctcacgggagcggac
ttcgtcgtggttgccttccagatcggcggctacgagccatgcaccgtgacagatttcgag
gtgccgaaaaaatacggactgcgccagacgatcgccgacacgctcggcgtcggcggcatc
atgcgggggttgcgcaccgtcccgcatctctggaagatctgcgaggacatgctcgaggtc
tgccccgaggcgatcctcctgcaatatgtaaacccgatggcgatcaacacctgggcgatc
gccgagaggtatccggccatcaagcaggtgggcctctgccactccgtgcagggcacggcc
tatgaactcgcccgcgatctcgagataccgctcgaggagatccgctatcgcgccgccggc
atcaaccacatggccttctatctgaaattcgagcaccgtcagaaggacggcagctatcgt
gatctctatccggaccttatccgcggctaccgcgaggggcgctttccgaagccgagccat
tggaacccgcgctgcccaaacaaggtacgttacgaaatgctgacgcggctcggctatttc
gtcaccgaaagctcggagcatttcgccgagtacacgccctatttcatcaaggaggggcgt
cccgatctgatcgaaaaattcgggattccgctcgacgagtatccgaagcgttgcatcgag
cagatcgagcgctggaagggccaggcggccgccttcaaggaggcggagacgatggaagtc
gcagagagccgcgaatatgcctcctcgatcatgaactcggtctggaccggcgagccctcg
gtgatttacggcaacctcagaaacaatggctgcatcacctcgctgccggaaaactgcgcg
gcggagatgccgtgtctcgtcgatcagtcgggtattcagccgacccatatcggcgcgctg
ccgccgcaactcacggcgttgatccgcaccaacatcaacgtacaggagttgacggttcag
gcgctcgtcactgaaaaccgggagcatctctaccatgcggcaatgatggatccgcatacc
gccgccgagctcgacctcgaccagatctggtcccttgtcgacgatctgctcacagcgcac
cgcgactggatcccggaatgggcccgcgtcgcgcagaaggtagcggccgcctga

DBGET integrated database retrieval system