KEGG   Sinorhizobium medicae: Smed_4242Help
Entry
Smed_4242         CDS       T00555                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smd  Sinorhizobium medicae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Smed_4242
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Smed_4242
   00650 Butanoate metabolism
    Smed_4242
  Lipid metabolism
   00071 Fatty acid degradation
    Smed_4242
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smed_4242
   00310 Lysine degradation
    Smed_4242
   00360 Phenylalanine metabolism
    Smed_4242
   00380 Tryptophan metabolism
    Smed_4242
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Smed_4242
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Smed_4242
   00281 Geraniol degradation
    Smed_4242
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Smed_4242
   00627 Aminobenzoate degradation
    Smed_4242
   00930 Caprolactam degradation
    Smed_4242
Enzymes [BR:smd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Smed_4242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p1: 
UniProt: 
Position
pSMED01:727644..728714
Genome map
AA seq 356 aa AA seqDB search
MEMQATFPEVIVERQGAIGRLRLNRPRALNSLNRAMIRAIAAALTEFERDPAIAAVLVTG
EGERGLCAGGDIRMIYESGRERPEEGAQFWREEFIVNSRISAYSKPYVAIMDGIVMGGGV
GVSSHGSHRIVTERTRFAMPETGIGYFTDVGATWLLPRAPGEFGTYLGLTGRDIGAAAVI
HARLGDSFVPSERIDELVAILASLPASAKAEDVSAAIRTVSAQAPASALLDHQPVIDRCF
ASDTVEEILGALENEGTDFSRETLDLLKTRSAISLKLTLALLRAGRASASLDECLEREYA
ATLGMLSNPDFYEGVRAAVIDKDRNPKWSVGLSQVTPAVLDRFQRNEGAPLFAGQA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcaggcaacgtttccggaggtcatcgtcgagcgccagggcgctatcggcaga
ctgcggctcaaccgtccgcgggcactgaacagcctcaatcgcgcgatgatccgcgcgatc
gctgcggcgctgacagaattcgagcgtgatccggcgattgccgcagtgcttgtcaccgga
gaaggtgaaaggggcctctgcgccggcggcgacatccgcatgatctacgaaagcggccgc
gaacggcctgaggaaggtgcgcagttctggcgcgaggagttcatcgtcaacagccgaatt
tccgcctattccaagccctatgtcgcgatcatggacggcatcgtcatgggcggcggcgtc
ggcgtttcctcccatggcagccaccgcatcgtgaccgagagaacgcggttcgccatgccg
gaaacggggatcggctatttcaccgatgtcggcgcgacctggctcctgccgcgcgcgccg
ggcgaattcggtacctatctcggcctcaccggccgggatatcggggcggcggcggtcatc
catgcgcggcttggcgacagcttcgtgccctcggagaggattgatgaactcgtcgccatt
ctcgcctcgctgcccgcttcggccaaggccgaggatgtttcggcggcgatccgcaccgtc
tcggcccaggcgccggcttcggcgctgctcgatcatcagcccgtcatcgaccgctgcttc
gcttccgatacggttgaggaaatcctcggcgcgctggaaaatgagggcacggacttttcg
cgcgagacgctggacttgctgaaaacccgatcggcgatcagcctcaagctgacgctcgct
ttgctgcgggccgggcgcgccagcgccagcctggacgaatgcctggagcgggaatatgcc
gcgaccctcggtatgctttccaatccggatttctacgagggtgtcagggcagcagtgatc
gacaaggatcgcaatcccaaatggtccgtcgggctttcgcaggtgaccccggcggtgctc
gaccgcttccagaggaacgaaggcgccccgctttttgccgggcaggcgtag

DBGET integrated database retrieval system