KEGG   Sinorhizobium medicae: Smed_4278Help
Entry
Smed_4278         CDS       T00555                                 

Definition
putative PAS/PAC sensor protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
smd  Sinorhizobium medicae
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:smd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Smed_4278
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Smed_4278
Enzymes [BR:smd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Smed_4278
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Smed_4278
Two-component system [BR:smd02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Smed_4278
Bacterial motility proteins [BR:smd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Smed_4278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p1: 
UniProt: 
Position
pSMED01:767954..771037
Genome map
AA seq 1027 aa AA seqDB search
MTYEDNRFPIVGIGASAGGIPAMQGFFKGLPVNSNMAFVIVTHLSPEHESQLHEVVARYT
DLPVLVAEDGMAAQPNHVYVMPQNAILSIAGGHLRLRKPDAATRERKPIDIFLSTLAEDQ
GEQAVGIILSGGDSDGTLGAKAIKEHGGLTLAQASDGSGPRNPDMPQSAISSGVIDLAVT
AEEMGEKLIAYANGFMAAQDVATEETPDAREARSEIYGLLRRHSGHDFSGYKSKTFLRRV
RRRMQILQVRALPDYLKLLRRDPSEVTNLFRDLLINVTNFFRDQDAFKALEQLVIPRLFE
GRKAGEPVRVWVPGCATGEEVYSLGILMRERMEKLADMPRVQIFATDIDESALGVARAGR
YPEALLQGLSPERIARHFNCDGASFVISSDVRELCIFSPHSVTRDPPFSRMDLVSCRNLL
IYLDQETQKRVISTFHYALKPGGYLFLGTSESIGQHGEHFSTIDKKNRIFQARGHDAVPR
VPALVGPPKTVNTADGRIHGLRIGTYPLRQVVEAHVLERFAPAHVVVNADGEAVYYSART
GKYLEVPQGAPSRQILTTARRGLRLDLRAALREAASARKVVVRENALLEDDDDRVQRVNL
TVEPLADGAGGEPLYLVVFDPIGPLQSRAEAEHSGYDADTAAILESELRETRERLQSTIE
EYETALEELKSSHEELVSVNEEAQSTNEELEASKEEMQSLNEELSTINAELTAKVEELDR
ANSDLKNLFESMQIATVFLDRNLVIRNFTPAASSFFNIRPSDVGRPLTELSSKLDYPELK
EQIASVFKTGEAVEHHLARDQNGKHFLVRLIPYRDDAARVDGVVVTLVDVTKMAEAEAHQ
QMLVSELNHRVKNMLAVVISIANHSMQTARSPNEFNQALIGRLQAMGRAYGLLTETHWTA
APVDHLIRQEIEAFGTGRFEVNGPDIHLEPQQGLSIGMVIHELATNASKYGALSKSEGKV
LVGWQSANGVFRLTWQESDGPPVSEPEREGFGLSLLKGEIGYRLDGEVETFFRPEGLFVR
IAFPFER
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgaagataacagattcccgattgttggcatcggcgcgtcggccggtggtatt
cctgcaatgcaggggttcttcaagggtcttccggtcaattccaacatggccttcgtgatc
gtgacgcatctcagccccgagcatgagagccaacttcacgaggtggtcgcgcgctacaca
gacttgccggtgttggtggcggaggatgggatggcggcccagccaaatcatgtctatgtc
atgccgcagaatgccatcctctcgatcgcaggcgggcacttgcgtctgcgcaagcccgac
gccgccacgcgggagcgcaagccgatcgatatctttctgagcacgctggcggaagatcaa
ggcgagcaggcggtcggtatcattctttccggcggcgacagcgatggaacgctgggggcg
aaggcgatcaaggagcatggagggctgacactcgcgcaggcgagcgacgggtcaggtccg
cgtaacccggacatgccgcaaagcgcaatctccagcggcgtgatcgacctggcggttaca
gccgaagagatgggcgagaagcttatcgcctatgccaacggtttcatggctgcccaagac
gttgcgacagaggagacgcccgacgcccgggaagctcgctcggagatctatggacttctc
cgcaggcattcgggacatgatttctcagggtataaatcaaaaacgtttctacgccgcgta
agaagacgcatgcagattcttcaggttcgagcgctgccggattacttgaagctgctcagg
cgcgacccctcagaggtgacgaacctcttccgcgacctattgatcaacgtcaccaatttc
ttccgcgaccaggatgcgttcaaggcacttgagcaactggtgataccgcgcctgttcgaa
ggccgaaaagcgggcgagcccgtgcgtgtatgggttccaggctgcgcgacgggggaagaa
gtctattcccttggcatcctcatgcgcgaacgcatggagaagctggcggacatgccgcgg
gttcagattttcgccacagacattgatgaatccgctctcggtgtcgcccgggccggccgt
taccctgaagcgctgctgcaaggcctgtcacctgagcgcatagcaagacacttcaattgc
gacggcgccagcttcgtgatcagcagtgatgtgcgcgagctctgcatcttctccccgcat
agcgttacgcgcgatccgccgttctcgcgcatggatctggtatcctgccgcaatctgctg
atctatctggatcaagagacgcagaaacgcgtcatctccacattccattatgcgctgaag
ccgggtggctatctttttctcgggacgtccgagagtatcggtcagcacggggagcatttc
tcgaccattgacaagaagaatcgcattttccaggcgcgggggcatgatgcagtgccccgt
gttccagccctcgttggtcctcccaaaacggtgaacactgccgatggccgtatccacggt
ctcaggatcggcacctatccgctgcggcaggtggtcgaagcgcatgttctcgagcgcttt
gcccccgcgcatgtcgtcgtcaacgccgacggcgaggcggtctactactccgctcgcacg
ggaaaatacctcgaagttccccagggcgccccgagccggcagattcttacgactgcaaga
cggggcctgcggctcgacttgcgggcggcgctgcgcgaggccgcctcggcacgaaaagtt
gtggtacgcgaaaatgctttgctggaggacgacgacgatcgggtgcaacgggttaatcta
accgtcgagccattggcggacggcgccggtggcgagcctctttatctggtcgtgttcgat
cccatcgggcctctacaaagccgggcggaggccgagcattccggatatgacgcggatacg
gcggctatcctggagagtgagcttcgcgagacgcgcgagcgactgcaatccaccatcgaa
gaatacgagacggctcttgaagagctcaagtcctctcacgaagagcttgtttccgtcaac
gaggaggcgcagtcaaccaatgaggagctggaagcctccaaggaggaaatgcagtcgctc
aacgaggaactgagcacgatcaatgcggaactgaccgcaaaggtcgaggaactggaccgt
gcgaacagcgacctgaagaacctgttcgagagcatgcagatcgcaacggtgtttctcgac
cgcaacctcgttatccgcaatttcacaccggctgcctcttcgttcttcaacatccggccg
tccgacgtggggcggccccttaccgagctttcaagcaagctcgactatccggaactcaag
gaacagatcgcttcggtcttcaagaccggagaagccgtggaacaccatcttgcccgcgat
cagaacggaaagcactttcttgtacgcctgatcccctatcgcgacgacgcagcacgcgtc
gatggtgtcgtggtcacgcttgtcgatgtgacgaagatggccgaggccgaggcgcaccag
cagatgctggtctcggaactcaatcaccgggtcaagaacatgcttgcagtggtgatcagc
atcgccaatcatagcatgcagaccgcccggtcaccgaacgagttcaatcaggcgctgatc
ggccgtctgcaggcgatggggcgggcttatggactgttgaccgagacgcactggaccgct
gctcccgtcgatcacctcatcaggcaggaaatcgaagccttcggcacaggtcgcttcgaa
gtgaacgggcctgacatccacctcgaacctcaacaggggctttctataggcatggtcata
cacgaactggcgaccaatgcgtctaaatacggagccctgagcaaatccgaggggaaggta
ctggttggctggcaatcggcgaatggcgtcttccgactcacctggcaggaaagtgacggt
ccgccggtgagtgaaccggagcgggagggcttcggcctgtctctgctcaaaggagaaata
ggctacaggctcgatggcgaggtggaaacgttcttccgtccggaaggtctgttcgtgcgc
atagcttttccgttcgaaaggtag

DBGET integrated database retrieval system