KEGG   Sinorhizobium medicae: Smed_4448Help
Entry
Smed_4448         CDS       T00555                                 

Definition
(RefSeq) XRE family transcriptional regulator
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI_p1: 
UniProt: 
Position
pSMED01:932533..933114
Genome map
AA seq 193 aa AA seqDB search
MLSDTLSNELQRYAIGPRIKALRLRKKLGLVQLAGHTGLSPAMLSKIERGQMFPTLPTLL
RIAMVFGVGLDHFFNVDKEEPLIAIVRKEQRLKLPSPPGEKHPAFLFESLDYPASDRRMD
AFYAEFPVDSPPSEPHQHGSAEFIYVLSGRLIVNVNGKECALDTGDAVYFDSSVPHSYRH
EGKEISTAIVVTS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgctctctgatacgctgtctaacgagctccagcgctacgcaatcggccctcgtattaag
gccctgcgcctgagaaagaagctgggactggtgcagttggctggccatacagggctctcg
cctgcgatgctctcgaagatcgagcgcgggcagatgtttccaacactgcccacgctgctt
cggatcgccatggttttcggcgtcggcctcgatcatttcttcaatgtggataaggaggag
ccgctcatcgcgattgtccggaaggagcagcgtctcaaacttcctagcccgccaggcgag
aagcacccagcctttctattcgaaagcctggactatcccgcttctgaccgccgcatggat
gcgttctacgccgaattcccggtcgattcgccgccctcagagccgcatcaacatggcagc
gctgagttcatctacgtgctcagcggtcggcttatagtcaatgttaatggcaaggagtgc
gcgctggatacgggggacgctgtgtatttcgactcgagcgttccgcacagttaccgccat
gaaggcaaagaaatctcaaccgcgattgttgtgacttcatag

DBGET integrated database retrieval system