KEGG   Sinorhizobium medicae: Smed_4463Help
Entry
Smed_4463         CDS       T00555                                 

Definition
(RefSeq) HipA domain-containing protein
  KO
K07154  
serine/threonine-protein kinase HipA [EC:2.7.11.1]
Organism
smd  Sinorhizobium medicae
Brite
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Smed_4463
Protein kinases [BR:smd01001]
 Serine/threonine kinases: Other
  Bacterial family
   Smed_4463
Prokaryotic defense system [BR:smd02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   HipA-HipB
    Smed_4463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI_p1: 
UniProt: 
Position
pSMED01:943842..945164
Genome map
AA seq 440 aa AA seqDB search
MTSKADATEAFVWIWLPGATEPVVAGRLFQEGERLLFNYGASYRGRKTAIPIYEPELPLQ
EGAIAPINGLQMASCIRDGSPDAWGRRVIINRLTGKKPDADGVPEISELTYLLHSGSDRT
GALDFQASATEYVPRRAAQASLDELMEAAALVEKGVPLTPALAQALNHGTSIGGARPKAL
INDDTKKFIAKFSASNDTYSVVKAEFIAMRLASASGLDVASVSITRAAHKDVLLIERFDR
RHTKEGWTRQAMVSALTILGLDEMMARYASYEDLAELIRHRFTAPKDTLKELYGRICFNV
LCGNTDDHARNHAAFWDGKMMTLTPAYDICPQSRTGTEATQAMLIKGEGRASTLANCLAA
APDYHLKEADATALIEHQITTIAEQWQAVCAEAELTPVDRQFFAGRQFLNNYAIEGLEGH
KALHDAFGAARKALIASGDA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacttctaaggcggatgccaccgaagcctttgtctggatttggctaccgggcgcaaca
gaaccggttgtggcaggccgcctcttccaagagggcgagcgcctgctctttaactacggc
gccagctaccgcggccgaaagaccgccattcctatctatgagcccgaacttccccttcag
gaaggcgcgattgcgcccatcaacggcttgcagatggcgagctgcattcgtgacggatcg
cccgatgcgtggggccgccgcgtgatcatcaacaggctgacgggcaagaagcccgacgct
gacggcgtgccggagatcagcgagcttacctacctgctccattcaggctccgaccggacg
ggcgccctcgattttcaggcatcggcgacagaatatgtcccccgccgtgccgcgcaggca
tcgctcgacgaactcatggaagcggccgccctcgtcgaaaagggcgtccctttgaccccg
gcgctcgcccaggccctcaaccacggcacctcgatcggcggcgcgcgccccaaggcgctg
atcaacgacgacacaaagaagttcatcgctaaattctcggcgagcaacgacacctacagc
gtcgtgaaggctgaattcatcgcgatgaggctggcgagcgccagcgggctcgacgtggca
tccgtatcgataacccgtgccgcgcataaggacgtgctgctgatagagcggtttgaccgc
aggcacaccaaggagggctggacgcggcaggcgatggtctcggcgctgacgatactgggc
cttgatgagatgatggcccgctatgcttcttatgaggatttggcggagctgatccgccat
cgcttcactgcccccaaggatacgctcaaggagctctacgggcgtatctgcttcaacgtg
ctgtgcggcaacaccgacgaccatgcccgtaaccacgcggcattttgggacggcaagatg
atgacactgacgcccgcctatgacatctgcccgcaaagccgcacgggcaccgaagccaca
caggccatgctgatcaagggcgagggtcgcgccagcacgctggcgaattgccttgcggcc
gcgccggattaccacctgaaagaggcggacgcaaccgcgctgatcgaacaccagatcaca
accatcgccgaacaatggcaggcggtctgcgcggaagccgaactgaccccggtcgaccgc
cagtttttcgccggacgccagtttctcaataactacgccatagaggggctcgaaggccac
aaggcgctgcacgatgcgtttggtgccgcccggaaggcgctgatcgcaagcggagacgcc
tga

DBGET integrated database retrieval system