KEGG   Sinorhizobium medicae: Smed_4470Help
Entry
Smed_4470         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI_p1: 
UniProt: 
Position
pSMED01:952030..952284
Genome map
AA seq 84 aa AA seqDB search
MIKFIDPDHPFYRPLWIRLLIIVFCAVWTAVEFYGGQTMWGTIFLVVTAYAGATLLVFYR
PKEEEQGKSGATGKTNEGTSDGTN
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaatttatcgatccggatcaccccttctatcgtcccttgtggatccggctgctg
atcatcgtgttctgcgcggtatggacggcggtggaattctacggcggacagacgatgtgg
ggaacgatctttctcgtggtaaccgcctatgccggcgcgacccttcttgttttttaccga
ccgaaggaggaggagcagggcaagagcggcgctaccggcaagacgaatgagggcacgagt
gacggcacgaactga

DBGET integrated database retrieval system