KEGG   Sinorhizobium medicae: Smed_4475Help
Entry
Smed_4475         CDS       T00555                                 

Definition
(RefSeq) monosaccharide-transporting ATPase
  KO
K10547  putative multiple sugar transport system permease protein
Organism
smd  Sinorhizobium medicae
Pathway
smd02010  ABC transporters
Module
smd_M00216  Multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:smd00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Smed_4475
Transporters [BR:smd02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Multiple sugar transporter [MD:M00216] [OT]
    Smed_4475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-GeneID: 5318177
NCBI-ProteinID: YP_001313208
JGI_p1: Smed4475
UniProt: A6UHZ5
Position
pSMED01:956850..958064
Genome map
AA seq 404 aa AA seqDB search
MVADTSTQTTKPSIGDYLRNNIREYGLLVALVIIMLFFQFVTNGVLFRPVNITNLVLQNS
FIVIMALGMLLIIVAGHIDLSVGSIVAFIGAISAIMLVKWGLPAFVVVPACLVVGGTMGA
AQGYWVAYQKIPAFIVTLAGMLVFRGMTYVVLGGRPIGPFPKEFQILSTGFVPDFLYFLN
PSPDLIKNMVALVAVLLLVGYAIYAGLRNRRINEQHGSENEPFIFFAIQMAVIGVVALFI
GFQLSTYRGLPNVLIVMGVLIALYTFVTSRSTVGRRIYAMGGNEKAAKLSGINTERLTFY
AFVNMGALAALAGMIITARLNSATPKAGVGFELDVIAACFIGGASASGGVGKITGAVIGA
LIMGVMNNGMSIMGIGIDYQQLIKGLVLLAAVFFDVYNKNKGKG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgatacgagcacccaaaccaccaaaccgtctatcggtgactacctcaggaac
aatattcgcgaatacggcctgctggtcgcgctcgtgatcatcatgctgttcttccagttc
gtcaccaacggcgtcttgttcaggccggtcaacatcaccaatctggtgctgcagaattca
ttcatcgtgatcatggccctggggatgcttctgatcatcgtcgcagggcatatcgatctt
tcggtcggctccatcgtcgctttcatcggcgcgatctcggccattatgctggtcaaatgg
gggctgccggcctttgtcgtcgtacctgcctgtctcgtcgttggcggcactatgggagct
gcgcagggatattgggttgcctaccagaagatcccggcctttatcgtgacgctggcgggc
atgctggtcttccggggtatgacctatgtggtcctcggcgggcgccccatcggccccttc
ccgaaggagttccagatactctccacgggtttcgttccggattttctctacttcctcaat
ccgagccccgacctgatcaagaacatggtggcgctcgtggccgtgctgctgctggtcggc
tatgcgatttatgcgggcctgcgcaatcgccggatcaacgaacagcatggtagcgagaac
gagcccttcatcttcttcgccatccagatggccgtgatcggcgtcgttgcgctcttcatc
ggctttcagctttcgacatatcgcggcctgcccaacgttctcatcgtcatgggcgtgctg
atcgccctttataccttcgtcacgtcccgctcgacggttggccgacggatctacgcaatg
ggcggaaacgagaaggctgccaagctctccggcatcaataccgagcggttgaccttctac
gccttcgtgaacatgggcgcgcttgctgcgcttgccggcatgatcattacggcgcgcctg
aattcggcaaccccgaaggccggcgtcggcttcgaactcgacgtgatcgccgcctgtttc
atcggcggcgcttccgcctcgggcggcgtgggcaagatcaccggcgcggtgatcggcgct
ctcatcatgggcgtcatgaacaacggcatgtcgatcatgggcatcggcatcgattaccag
cagttgatcaagggcctcgtgctgctcgcagccgtgttctttgacgtctacaacaagaac
aagggcaagggctga

DBGET integrated database retrieval system