KEGG   Sinorhizobium medicae: Smed_4479Help
Entry
Smed_4479         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5318344
NCBI-ProteinID: YP_001313212
JGI_p1: Smed4479
UniProt: A6UHZ9
Position
pSMED01:962787..963467
Genome map
AA seq 226 aa AA seqDB search
MPNKALVLSVGLLTSLAFSPSFAQSVGGNGGLNVGVSLGGSNGVNANVGASLGGSRGVKA
DADASVGGSRGVNTSATASVGGSHGVNADVDASVGGSRGLNSNVSANVGGSNGIDADANV
SLGGRRGLNANVSANAGGGSGAGLGVGLGLGGSSAGGVGPGSGGGAPGASGGAGIGAPGQ
SAVAAFNAMSPSERRMVLKRCRDVVNGGYDRGLVALCRLLQSTASR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgccgaataaagcccttgttctgtctgtcggtctgttgaccagcctggccttttccccg
tcttttgcccagagcgtcggcgggaacggaggattgaatgttggagtctcgttgggaggc
tcgaacggcgtaaacgccaatgtcggcgcttcccttggcggctccagaggtgtcaaagcc
gacgccgacgcttccgtcggaggatcgcgcggggtgaacacctcggcgactgcatccgtt
ggcggtagccacggtgtaaacgccgatgtcgatgcaagcgtcggaggcagccgcggcctc
aacagcaatgtcagtgcaaatgtcggcggcagcaacggcatcgacgccgatgcgaacgtc
tcgctcggaggccgtcgcggtctcaacgctaacgtttctgctaacgccggcggcggcagc
ggtgcggggctgggcgttgggctcggtctcggcggcagctctgccggcggggtcggaccc
ggcagtggcggtggtgcaccaggtgccagtggcggggccggaatcggggctcccggccaa
agcgcggtcgcagctttcaatgccatgtcccccagcgagcgccgcatggtgctgaagcgt
tgccgtgatgtcgtcaacggtggctatgacaggggtttggtcgcgctgtgtcgactgctg
cagtcgactgcatcgcgctaa

DBGET integrated database retrieval system