KEGG   Sinorhizobium medicae: Smed_4481Help
Entry
Smed_4481         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI_p1: 
UniProt: 
Position
pSMED01:complement(964494..965435)
Genome map
AA seq 313 aa AA seqDB search
MLGRTANGLYWMFRYIERTENSARLIDAGLRMSLTRSESAEDDWDGVLQSAGVRGLYDQV
HEGLTSGDAIDFLLRDRANPSSVISCIEEGRNNARMVRTALTRETWEAINECWIEMKGIL
ARRARTTDMPEIIDTIKRRTGLIRGAFHGTMLRNEIFNFSRIGTFIERADNTARILDVKY
YVLLPAISAVGSSIDNVQWESILRSVSAHRSYGWVYDAELRPANIADFLIANGRMPRSLA
YCYEKIVSNLAYLAREYGKRHAAHETAERTLGFLRSQSIANIMDRGLHEYLEDFISQNNR
LGQEISDGYRFYH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgctgggaagaactgcaaacggcctctactggatgttccgctatatcgagcggacggaa
aacagtgcccgccttatcgatgcaggattgcgcatgtcgctgacccgcagcgagtcggcc
gaggacgactgggacggagtgcttcaaagtgccggcgtgcgcggactctatgatcaggtt
catgaagggctgacgagtggcgacgccatcgatttccttctgcgcgaccgcgccaaccct
tcaagcgtcatttcctgcatcgaggagggccgcaacaatgcccgcatggtccgcacggcc
ctgacgcgggagacctgggaagcgatcaacgaatgctggatcgagatgaagggaatcctc
gcaagaagggcaaggaccaccgacatgccggaaataatcgacacgatcaagcggcgaacg
gggctgatccggggcgcgtttcacggcacgatgctcaggaacgagatcttcaacttctcg
cgtatcggcacctttatcgagagggcggacaacacagcccgtattctcgacgtcaaatat
tacgtgctcctgccggcgatctccgcggtcggctcgtctatcgacaacgtccaatgggaa
tcgattcttcgctcggtttccgcgcaccggtcctatggctgggtctatgatgccgaactc
aggcccgccaacatcgccgacttcctgatcgcgaacggccgcatgccgcgctcactcgcc
tattgctacgagaagatcgtctccaacctcgcctatctcgcgcgcgaatacggcaaacgg
cacgccgcgcacgagacggctgagcggacccttggttttctgcgcagccaatcgatcgcc
aacatcatggatcgtggcctgcacgagtatctcgaggatttcatcagccagaacaatcgc
ttgggtcaggaaatttccgatggctaccggttctaccactga

DBGET integrated database retrieval system