KEGG   Sinorhizobium medicae: Smed_4492Help
Entry
Smed_4492         CDS       T00555                                 

Definition
(RefSeq) hydroxyisourate hydrolase
  KO
K07127  
5-hydroxyisourate hydrolase [EC:3.5.2.17]
Organism
smd  Sinorhizobium medicae
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Smed_4492
Enzymes [BR:smd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.17  hydroxyisourate hydrolase
     Smed_4492
Transporters [BR:smd02000]
 Other Transporters
  Others
   Smed_4492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI_p1: 
UniProt: 
Position
pSMED01:976237..976599
Genome map
AA seq 120 aa AA seqDB search
MSKTGRLTTHVLDTALGRPAQAMRIDLYRLEGEVRQLIRTARTNSDGRIDEPLVEGVDFT
NGTYELVFHAGEYLRAMDVALPDPAFLDLVPLRFGVADSRNHYHVPLLLSPYGYSTYRGS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagacggggcgcctgacgacccatgttctggacacagccctcggcagacccgct
caggcaatgaggatcgatctctatcgtctggaaggcgaggtgcggcagctgatccgtacg
gcccgaaccaatagcgacggccgtatcgacgagccgcttgtcgagggtgtcgatttcacc
aacggcacctacgaactggtcttccatgcgggcgaatatctcagggccatggacgtagcg
cttccggatcccgcgttcctggacctggttccgctgcgattcggtgtcgcggacagtcga
aaccattatcacgtgccgctgctgctctcaccctacggctattccacctatcgcggcagc
tga

DBGET integrated database retrieval system