KEGG   Sinorhizobium medicae: Smed_4499Help
Entry
Smed_4499         CDS       T00555                                 

Definition
(RefSeq) xanthine dehydrogenase small subunit
  KO
K13481  
xanthine dehydrogenase small subunit [EC:1.17.1.4]
Organism
smd  Sinorhizobium medicae
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Smed_4499
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Smed_4499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI_p1: 
UniProt: 
Position
pSMED01:complement(984136..985626)
Genome map
AA seq 496 aa AA seqDB search
MEQAPDSIRFILNDTEIALSDVAPTATLLDYLRLERRLTGTKEGCAEGDCGACTVLVGRL
AHDGEGGETTLVYESVNACIRFMGSLNATHIVTVEHLAGKDGKLHPVQQALVDFHGSQCG
FCTPGIVMSLYGLWLTNDRPGRAAIEKALQGNLCRCTGYEPIVRAAEAAAADRPDVLFDP
ITRVREAVRARLQELRQAERIEIRSGVDCLIVPADAADLARVLADRPAATIVAGCTDVGL
WVTKQMRPLNTVVFVNGIAELQRIESSKAGLTIGAGVSYSAAYEALSSAYPSFGRLLDRV
GGDQVRNMGTIGGNIANGSPIGDSPPPLIVLGATLTLRSHGGSRTLPLEDFFIAYGKQDR
RPGEFVESIFVPALPAGERFAAYKISKRRDEDISALLGAFRISLDGDRVKAARIAFGGMA
ATPKRAKVVEAALLGELWNEGTIRDAQSAFDTDYQPITDWRATGAYRLLAAKNLLMRFFL
ESTGETAQLRRFEEVA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggcacccgacagcatccgcttcatcctgaacgacacagagatcgccctttcc
gatgttgccccgacagcgacactgctggattatctgaggctggagcgccgcctcaccggc
accaaggaaggctgtgccgagggcgactgcggcgcctgtacggtgctcgtcggccggctt
gcccatgatggcgaaggaggcgagactaccctcgtctatgagagcgtaaacgcctgtatt
cgtttcatgggctcactcaacgccacacatatcgtcacggtcgagcacctggccggcaag
gacgggaagctccatcccgtgcagcaggcactcgtggattttcacggctcccaatgcggc
ttctgcacgcctggaatcgtcatgtcgctgtacgggctgtggctgaccaacgacagaccg
ggccgcgcggcaatcgaaaaggcactgcagggcaatctctgtcgatgcaccggctacgaa
ccgatcgtgcgcgcggcggaggccgcggcggcggatcgcccggacgttctcttcgacccg
atcacccgcgtgcgggaggcggtaagggcacgcctgcaggagctgagacaagccgaaagg
atcgaaatccgcagcggcgtggactgtctgattgtacccgccgacgctgccgacctcgca
cgtgtcctcgccgatcgtcccgcggccacgatcgtcgccggctgcaccgatgtcggactt
tgggtgacgaagcagatgcgaccgctgaatacggtcgtcttcgttaacggcatcgccgag
ctgcagcggatcgagagctcaaaagcgggtctgacgatcggagcaggcgtcagctactcg
gcggcatacgaggccctttcctccgcctacccgtcgttcggccggcttctcgatcgcgtc
ggtggcgatcaggtgcgcaacatgggcacgataggaggcaacatcgccaacggctcgccg
atcggggacagcccgccgccgctgatcgtgctcggtgcgacgcttaccctgcgctcccat
ggcggttcgcgcacgctcccgctcgaggatttcttcatcgcctatggcaagcaggatcgc
aggccgggggaattcgtcgaaagcatcttcgtcccggcgctgcccgcgggggagcgcttc
gccgcctataagatctcgaagcgccgcgacgaggacatttccgcgctgcttggcgccttc
cgcatctcgctcgacggagatcgggtgaaggcggcgagaatcgctttcggcggcatggcg
gcaacaccgaaacgggcaaaggtcgtcgaagcggccctgctcggcgaattatggaatgag
gggacgatacgcgacgcccagagcgccttcgataccgattaccagccgatcaccgactgg
cgcgccaccggcgcctatcgcctgcttgcggcgaagaatctgctgatgcgcttcttcctc
gagagcaccggggagacggcgcagctccggcggttcgaggaggtggcatga

DBGET integrated database retrieval system