KEGG   Sinorhizobium medicae: Smed_4504Help
Entry
Smed_4504         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4405 DUF4231
Motif
Other DBs
NCBI-GeneID: 5317944
NCBI-ProteinID: YP_001313237
JGI_p1: Smed4504
UniProt: A6UI24
Position
pSMED01:989154..989372
Genome map
AA seq 72 aa AA seqDB search
MNRSAWIRQIHRWLSIVFTVTVMANFSAMALGEPPVWVVYSPLLPLFLLLFTGLYMFALP
YSAKWRGGRPTA
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggagcgcctggatacgtcaaatccaccgctggttgtccatcgtcttcacggta
acggtcatggccaacttcagtgccatggcactgggagaacctcccgtctgggtggtctat
tctccactgcttccgctcttcctcttgctgttcacagggctctacatgtttgcgttgcct
tattccgcaaagtggcgcggcggacggcccacagcctga

DBGET integrated database retrieval system