KEGG   Sinorhizobium medicae: Smed_4512Help
Entry
Smed_4512         CDS       T00555                                 

Definition
(RefSeq) NnrU family protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI_p1: 
UniProt: 
Position
pSMED01:996217..996804
Genome map
AA seq 195 aa AA seqDB search
MAILLLGIIIFLGMHLIRVVAPGFRAGIIESRGKGTWMGLYTIVSLVGVCLIIYGFGQAR
GETGVLYNPPEFLRHIALLLMLIAFIVLAAGFLPAGRIAVALKHPQVLSIKIWALAHLLA
NGETSSVLLFGSFLAWAVILRISLKRRERAGEKVLPVFKSGRNDVLAVLTGLAAYVLFVW
KLHELVIGVPPVVIG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccatactccttctgggcatcatcatatttctcggcatgcacctcatccgcgtggtt
gcgcccggctttcgggccggcatcatcgaaagccgcggcaagggcacatggatggggctc
tatacgatcgtcagcctcgtcggtgtctgtctgatcatctacggtttcggtcaggcgcgt
ggcgaaaccggggtgctatacaatccgccggagtttttgcgccatatcgcccttctcctg
atgctcatcgccttcatcgtgcttgctgcaggctttctgccggcgggccgcatcgccgtg
gcgctcaagcatccgcaggtcctctcgatcaagatctgggcgctcgcgcacctgcttgcc
aatggcgagacgtcctcggtgctgctcttcgggtcctttcttgcatgggcggtgatcctg
cgcatctcgctgaaaagacgcgagcgcgcgggcgagaaggtgcttccggtcttcaaatcc
gggcgcaacgatgttctggcggtcctcacaggtctcgccgcatatgtgctctttgtctgg
aagctgcatgagctcgtgatcggcgttccgccggtcgtcatcggttag

DBGET integrated database retrieval system