KEGG   Sinorhizobium medicae: Smed_4523Help
Entry
Smed_4523         CDS       T00555                                 

Definition
(RefSeq) molybdopterin oxidoreductase
  KO
K00372  assimilatory nitrate reductase catalytic subunit [EC:1.7.99.-]
Organism
smd  Sinorhizobium medicae
Pathway
smd00910  Nitrogen metabolism
smd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Smed_4523
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     Smed_4523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4 Fer2_BFD
Motif
Other DBs
NCBI-GeneID: 5318498
NCBI-ProteinID: YP_001313256
JGI_p1: Smed4523
UniProt: A6UI43
Position
pSMED01:complement(1008892..1011549)
Genome map
AA seq 885 aa AA seqDB search
MAHEVKTTCPYCGVGCGVIARLGDDGAVSVKGDPEHPANFGRLCSKGSALAETLDLDGRL
LHPEIGGRRAGWSEALDLVAERFSHAIAEHGPDSVAFYVSGQLLTEDYYIANKLMKGFIG
SANIDTNSRLCMSSSVAGHRRAFGSDTVPGVYEDLELAELVVLTGSNLAWCHPVLYQRLS
AAKANRPEMKIVVIDPRRTMTADIADMHLAISPDGDVALFNGLLAHLAASGVIDRNYVSK
CTSGFDEAVAVASRLDLPAVSNATGLTQAQLRAFYRLFETTENVVTCYSQGVNQSAAGTD
KVNAIINCHLATGRIGRPGMGPFSLTGQPNAMGGREVGGLANMLAAHMDIEKSLHRDQVR
RFWGAPAVANKPGLKAVDMFRAVADGRIKALWIMATNPVVSMPDADAVEAAIKACPFVVV
SDIVRDTDTARHAHVLLPSLGWGEKDGTVTNSERCISRQRAFLRGPGEARPDWWQLAEVG
KRMGFAPAFAYNSQAEIFAEHAALSGFENNGRRDFDISAHAEIGGTAYDGLKPFQWPQTR
GSTPQQRRFFADGRYFHPDGRARFVAIEVPGPRRRDAAFPFTLNTGRVRDHWHTMTRTGR
SARLSGHLAEPFVEIHPRDAQAIGVSGADLVTLESPHGAAIVRALVTDRQAEGNLFVPMH
WNDQFASRARIDALVAPITDPVSGQPASKHMTVRAGRLAAAVYGFAVSAHKPAELDAAYW
AIARAEGGWRMELAFAEKEIDWTDWCRKTFGIASEIEPIGYTDRTSGELRLAFFEEDRLL
ATLFLSPQPVAVARNWAVSQLRASHHNLGKRFAVVAGRPGADTPDPGATVCSCFSVGVNQ
ITAAVRVGCHSVEAVGEKLSAGTNCGSCRAEIRGIINACLTVAAE
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgaggtcaagaccacctgcccctattgcggagtcggctgcggcgtcattgcc
cgtctgggtgatgacggcgccgtgagcgtaaagggagacccggagcatcctgccaatttc
ggcaggctctgttcgaaaggatcggcgctcgcagaaacgctcgatctcgacggccgcctc
cttcatccggaaatcggcggccgtcgcgcaggctggagcgaggcgctcgacctcgttgcc
gaacgcttttcgcatgctatcgccgagcacggtcccgattcggttgccttctacgtctcg
ggacagttgctgacggaggactattacatcgccaacaagttgatgaagggtttcatcggc
tcagcaaacatcgacaccaattctcggctttgcatgtcctcctccgtagcgggccaccgc
cgcgccttcggctcggatacggtgccgggcgtttacgaggacctggaactcgccgaactc
gtagtcctgacgggttccaatctggcctggtgccatccggtgctttatcagcgcctttca
gctgccaaggcgaaccgacctgagatgaagatcgtcgtcatcgatccacgccgcaccatg
actgccgacatcgccgacatgcacctggcgatctcgccggacggcgacgtcgccctcttc
aacggcctgcttgcccatctcgccgccagcggcgtgatcgaccggaactatgtctcgaag
tgcacgagcggtttcgacgaggccgtggcggtggcatccaggctcgatcttccggcagtt
tccaacgcgaccggcctgacgcaggcgcagcttcgcgcgttctaccggctcttcgagacg
actgaaaacgtcgtgacctgctacagccagggcgtcaaccagtctgccgccggtaccgac
aaggtaaatgccatcatcaattgccatcttgcgaccggacgcatcggccggccgggcatg
gggccgttttccctgaccggacagccaaatgccatgggcgggcgggaggtcggagggctg
gcaaacatgcttgcggcccatatggatatcgagaaatcgctccaccgtgatcaggtgcgc
cgtttctggggcgcgccggcagtggcgaacaagcccggcctcaaggcggtggacatgttc
cgcgccgttgcggacgggcggatcaaggccttgtggatcatggcaaccaatcccgtcgtc
tcgatgccggatgccgatgccgtcgaagcggcgatcaaggcctgccccttcgtcgtcgtc
tccgacatcgtgagagataccgacacggcccgccacgcccacgtgcttctgccctcgctg
ggttggggcgagaaggatggcaccgtcaccaattccgagcggtgcatctcgcgccagcgt
gcctttctgcgaggccccggggaggcgcggcccgattggtggcaactcgccgaagtcggt
aaacgcatgggcttcgccccagcattcgcctacaattcacaggccgagatcttcgctgag
catgcggcgctttcgggtttcgagaacaacgggcgccgcgatttcgacatcagcgcccat
gcggagatcggcggcaccgcttatgacgggctgaaaccttttcagtggccgcagaccagg
ggcagcacgccacagcaaaggcgctttttcgcggacggccggtacttccatccggatggc
cgcgcccgcttcgttgccatcgaggtgcccgggccgagacgccgcgacgcggccttcccg
ttcacgctcaataccggccgcgtgcgcgaccattggcacacgatgacgcgcaccggcagg
agcgcgcggctctccggccatctggccgagcccttcgtcgagattcacccgcgcgacgca
caggcgatcggcgtcagcggcgccgacctcgtgaccttggaaagtccgcatggggcggca
attgtccgggcactcgtcaccgaccgacaggcggaaggcaatctattcgtgccgatgcat
tggaacgatcaattcgcttccagggcgcggatcgatgcactggttgcgcccatcaccgac
cctgtttccggccagccggcatcgaagcatatgacggttcgtgcgggtcgccttgcagca
gcggtctatggcttcgcggtctcggcgcacaagcctgcggagctcgacgccgcctattgg
gcgatcgccagggccgaaggcggatggcggatggaactcgctttcgccgaaaaggaaatt
gactggaccgactggtgccggaagacgttcgggatcgcttccgagatagagccgatcggc
tatacggaccgcacctcaggcgagcttcgcctcgcctttttcgaagaggaccggctgctg
gccaccttgtttctttccccgcagcctgtcgccgtcgcgcgcaactgggcggtatcgcag
ctccgtgcgtcgcatcacaatcttggcaaacgtttcgcagtggtcgccggccgcccgggt
gccgacacccccgacccaggcgcgaccgtctgctcgtgtttcagtgtcggcgtcaaccag
atcaccgccgccgtgcgcgtcggatgccatagcgtcgaagcggtgggcgaaaagctcagc
gccggcaccaattgcggctcctgccgtgccgaaatcaggggaatcataaatgcttgcctc
accgtcgcagcagagtga

DBGET integrated database retrieval system