KEGG   Sinorhizobium medicae: Smed_4525Help
Entry
Smed_4525         CDS       T00555                                 

Definition
(RefSeq) nitrite reductase (NAD(P)H) large subunit
  KO
K00362  
nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
smd  Sinorhizobium medicae
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Smed_4525
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     Smed_4525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI_p1: 
UniProt: 
Position
pSMED01:complement(1011895..1014357)
Genome map
AA seq 820 aa AA seqDB search
MTETALEKLVVVGNGMAPGRMLEELFEKAPGRYAVTIFNAEPRVNYDRIMLSPVLSGEKD
YEEIIIHGDGWYIKHGITLYKGHKIVAIDREAKTVTSDHGVTESYDKLVIATGSVPFIIP
VPGKDLRGVITYRDLDDVQAMLLAAQSREKAVVIGGGLLGLEAAAGLQARGMDVTVLHVM
PTLMERQLDPAAGYLLQKAVEERGIKVLTKANTKRILGEEKVEGIELEDGRIIPATLVVM
AVGIRPNAGLAKEAGLAVNRGIVVDAGMQTSDGNIMALGECAEVGGMVYGLVAPLYEMAR
VAASHLAGDRRAAFAHSDTPTKLKVTGINLYSVGDFADGDGREEIVLRDATAGIYKRLVL
KENRIVGAVLYGDTGDGAWFNDLLKRGTDICELRDTLIFGQAYQGGSPLDPMAAVAALPD
DAEICGCNGVCKGKIVGAITSKGLTSLDDVRAHTKASASCGSCTGLVEQIMSLTLGDSYN
PAAVQPMCNCTDLGHDDVRRLIKAKKLKTIPAVMQELEWKTSCGCAKCRPALNYYLVCDW
PDEYADDYQSRFINERVHANIQKDGTYSVVPRMWGGVTNSRELRAIADVADKFNVPLVKV
TGGQRIDLLGIEKEDLPAVWADLNKAGFVSGQAYAKGLRTVKTCVGSDWCRFGTQNSTGL
GIRIEKFMWGSWTPAKLKMAVSGCPRNCAEATCKDIGVICVDSGYEIHFAGAAGLDIKGT
EVLGLVKTEDEALEHIVALTQMYREQARYLERIYKWAKRVGLDEIRRQIMGDAERRKAYF
DRFVFSQKFAQVDPWSERVSGKDKHEFRPMATVGFNQAAE
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaactgcactcgaaaaactcgtcgtcgtcggcaacggcatggctccgggccgg
atgctggaagagctcttcgaaaaggcgcccgggcgctacgccgtgaccatcttcaacgcc
gagccgcgcgtcaattacgaccgcatcatgctctctccggtactatccggtgaaaaggac
tacgaagagatcatcatccatggcgacggatggtacatcaagcacgggatcaccctatac
aaggggcacaagatcgttgcgattgatcgggaggcgaaaaccgtaacctccgaccacggc
gtcaccgaaagctacgacaagctggtgatcgccaccggttccgtgcccttcatcatcccc
gtgccgggcaaggacctgcgcggcgtcatcacctatcgcgatctcgacgatgtccaagcg
atgctgctcgcggcgcaatcgcgcgaaaaagccgtggtcatcggcggcggcctgcttgga
cttgaggcggccgccggccttcaggcgcgcggcatggacgtcaccgttctgcacgtcatg
ccgacgctgatggagcgccagctcgaccccgccgcgggttatctcctgcagaaggcggtc
gaggagcgcggtatcaaggtcctgaccaaggccaacaccaaacgcattctgggcgaggag
aaagtcgagggcatcgaactcgaggacggccggatcattccggcgacgctggtcgtgatg
gccgtcggtatccgtccgaatgcaggccttgccaaggaggccgggctcgccgtcaaccgc
ggcatcgtcgtcgatgccggaatgcagacgtccgacgggaacatcatggcgctgggcgag
tgtgccgaagtcggcggcatggtctacggtctcgtcgcgccactctacgagatggcacgc
gtcgccgcgtctcacctcgcaggcgaccgtcgcgctgccttcgctcactccgacaccccg
acgaaactgaaggtcacggggatcaacctctattccgtgggcgacttcgccgatggcgac
ggacgtgaagaaatcgtgctacgcgatgccaccgccggcatctacaagcggctggttctc
aaggagaaccggatcgtcggcgcagtgctttatggcgataccggtgacggtgcctggttc
aatgacctcttgaagcgcggcaccgatatttgcgagttgcgtgacacactgattttcggc
caggcctaccagggaggatctccgctggaccctatggcggccgttgcagccttgccggat
gatgcggaaatctgcggctgcaacggcgtgtgcaagggcaagatcgtcggggctatcacc
tccaaggggctgacctcgctcgacgacgtacgtgcccacaccaaggcgtccgcctcctgc
ggctcctgtacgggcctcgtcgaacagatcatgtcgctgacgcttggtgacagctacaac
ccggccgctgtacagccgatgtgcaactgcaccgatctcggccatgacgacgtgcggcgc
ttgatcaaggcgaagaagctgaagacgatccccgccgtcatgcaggaactcgaatggaag
acctcctgcggctgcgcaaagtgtcgtccggccctcaattactacctcgtctgcgattgg
ccggatgaatatgccgacgactaccagtcgcgcttcatcaatgaacgcgttcacgccaat
atccagaaggacggcacctattccgttgtaccccgcatgtggggcggcgtcaccaattcc
agggagcttcgggcgatcgccgacgtcgcagacaagttcaacgtgccgcttgtaaaggtg
accggcggccagcgcatcgatctgcttggcatcgagaaggaggacctgcccgccgtttgg
gcagacctcaacaaagcgggcttcgtctccgggcaggcttacgccaaggggctcagaacc
gtgaagacctgtgtcggctccgattggtgccgcttcggcactcagaattcgaccgggctt
ggcatccgcatcgagaaattcatgtggggctcctggaccccggcgaagctgaagatggcg
gtctccggctgcccccgcaattgcgcggaggcgacctgcaaggatatcggcgtcatctgc
gtcgactccggctacgagattcacttcgcaggtgccgccggtctcgacataaagggaacc
gaagtcctggggctggtcaaaaccgaggacgaggcgctcgaacatatcgtcgcgctgacg
cagatgtatcgtgagcaggcccgctatctcgagcgcatctacaaatgggcaaagcgcgtc
ggcctcgacgagatccgccggcagatcatgggcgatgcggaaaggcgcaaggcctatttc
gaccgcttcgtcttcagccagaaattcgctcaggtcgacccttggtcagagcgcgtctcc
ggcaaggacaagcacgagttccggccgatggcgacggtcggcttcaatcaggcagcggag
tga

DBGET integrated database retrieval system