KEGG   Sinorhizobium medicae: Smed_4533Help
Entry
Smed_4533         CDS       T00555                                 

Definition
(RefSeq) propionyl-CoA carboxylase
  KO
K01969  
3-methylcrotonyl-CoA carboxylase beta subunit [EC:6.4.1.4]
Organism
smd  Sinorhizobium medicae
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smed_4533
Enzymes [BR:smd01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.4  methylcrotonoyl-CoA carboxylase
     Smed_4533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI_p1: 
UniProt: 
Position
pSMED01:1020493..1022100
Genome map
AA seq 535 aa AA seqDB search
MTVLRSHISPSSEGFKANRAAMAEAIAAIEDAVRLAASGGGDKARERHVSRGKLLPRDRV
AALIDPGTPFLELGATAAHEMYNGDAPAAGLITGIGRISGRECMIVCNDPTVKGGTYYPM
TVKKHLRAQEIAAENRLPCVYLVDSGGANLPNQDEVFPDRDHFGRIFYNQANMSAAGIPQ
IAVVMGSCTAGGAYVPAMSDEAIIVEKQGTIFLAGPPLVRAATGEVVSAEELGGADVHTR
LSGVADHLARDDAHALALARRAVSALNYGKPWPVQRIDPEPPLYDPEEIAGIVPADLKTP
YDIREVIARLVDGSRFDEFKARFGTTLVCGFAHVHGIPVGIVANNGVLFSESAVKGAHFV
ELCAQRRIPLVFLQNITGFMVGRKYETEGIAKHGAKLVTAVATVKVPKITMLVGGSFGAG
NYGMCGRAFSPRFLWTWPNSRISVMGGEQAAGVLSSVRGEALKRSGLPWSEEEEARFRQP
VLDLFERQSHPLYASARLWDDGVIDPRKSRDVLALSLSAALNAPIEDTHFGLFRM
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgacggtattgcgttcgcatatttcgccttcctcggagggtttcaaagcgaaccgggcg
gccatggcggaggccatcgcggcgatcgaggacgcagtccggctggctgcatccggcggt
ggcgacaaagcgcgcgagcgacacgtcagccgtggaaagcttctgccgcgggatcgggtt
gccgctctcattgacccgggcacgccatttctggagctcggagcgaccgcggcgcacgag
atgtataatggtgacgcgccggccgcggggttgatcaccggcatcggccggatctcaggc
cgcgaatgcatgatcgtttgtaatgatccgacggtcaaaggcggcacctattatccgatg
acggtcaagaagcatttgcgggcccaggagatcgcggcggaaaaccggctcccctgcgtc
tatctcgtcgattccggcggggccaacctgccgaaccaggacgaggtcttcccggatcgt
gatcatttcggccgcatattctacaaccaggccaatatgtcggcggccggcattccccag
atcgcggtggtgatgggctcctgcacggcaggcggcgcctatgtgccggccatgtctgat
gaagccattatcgtcgaaaaacagggcaccatctttctggcaggccccccgctggtccgc
gcagcgaccggcgaggtcgtctctgccgaagagcttggcggcgccgatgtccacacgcgc
ctctcgggcgttgccgatcaccttgcgcgcgacgatgcccacgcgcttgcgctggcgcgc
cgcgccgtttcggccttgaactacgggaagccctggccggttcagcgaatagatccggag
ccgccgctctacgatccggaagaaatcgcaggcatcgttcccgccgacctgaagacgccc
tacgacatccgtgaggtgatcgcccgacttgtggacggctcccgattcgacgaattcaag
gcgcgcttcggcacaacgctcgtttgtggcttcgcccatgtccacggcattcccgtcggc
atcgtcgccaataatggcgttcttttctcggagtctgcagtcaagggggcgcattttgtc
gaactttgcgcgcagcgcaggattccgctcgtttttctgcagaacatcaccggcttcatg
gtgggccgcaaatatgagacggagggaattgccaagcatggcgccaagctcgtcaccgca
gtcgcgacggtgaaggtgcctaagatcacgatgctggtcggcggttcgttcggggctggc
aattacgggatgtgtgggcgtgctttctccccgcgctttctctggacctggcccaacagc
cgtatttcggtgatgggcggtgagcaggcggcaggcgttctctcctccgtgcgcggtgaa
gccctgaagcgctcgggattgccttggagcgaagaggaagaagcccgttttcgccaaccg
gttctcgatcttttcgagcgccaaagccatccgctctacgcgtcggcaaggctgtgggac
gacggcgtgatcgatccgcgcaagagccgcgacgtgctggcgctttctctctcggccgct
ttgaacgcgccaatcgaggacacgcacttcggactgttcaggatgtaa

DBGET integrated database retrieval system