KEGG   Sinorhizobium medicae: Smed_4536Help
Entry
Smed_4536         CDS       T00555                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA lyase
  KO
K01640  
hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
smd  Sinorhizobium medicae
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Geraniol degradation
Butanoate metabolism
Metabolic pathways
Module
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Smed_4536
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Smed_4536
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smed_4536
  Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Smed_4536
Enzymes [BR:smd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     Smed_4536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI_p1: 
UniProt: 
Position
pSMED01:1024500..1025369
Genome map
AA seq 289 aa AA seqDB search
MTPPARESATIVEMAPRDGLQNEPRLVATEDKIRLVDLLSDCGYGRIEVTSFVSPRWVPQ
MADAPAVMTGILRRAGTRYAALTPNMRGFEAALAARADEVAVFASASESFSEKNINCSIA
ESIERFRPVAEASRRHGVPLRGYVSCVVECPYEGAIAPAAVARVTRLLAELGCYEISLGD
TIGSGTPESVDRMLTTVRREVDAKALAGHFHDTSGRALENIGVALEHGLRVFDASAGGLG
GCPYAPGAAGNVDSLEVRAFLETRGFNTGLDLEKLDRAGAFARSLRSAA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgccggcaagggagagcgccacgatcgtcgagatggcgccgcgcgacggcctg
cagaacgagccgcggctcgtggctacggaggacaagatcaggctcgtcgatctgctctcc
gactgcggctacgggcgcatcgaagtgacgagtttcgtcagcccgcgctgggtcccgcaa
atggccgacgcacccgccgtcatgaccggcattcttcgtcgcgccggcacgcgctacgcg
gctttgacgccgaacatgcgcggcttcgaagcggcgcttgcggcgcgcgcggacgaagta
gcggtcttcgcttccgcgtcggagagcttctccgagaagaatataaactgctcgatcgcc
gagagcatcgagcgctttcgcccggtcgccgaagccagccggcgtcatggcgttcccctg
cgaggctatgtgagctgcgtggtcgaatgcccctatgagggcgcgatcgcgccggcagcg
gtcgcccgcgtcacacggttgttggccgaactaggctgctacgagatcagtctcggagat
acgatcggaagcggcacgcccgaatctgtcgatcgtatgctgacaacggtacgccgcgag
gtcgatgccaaggcacttgccggtcattttcacgatacatccggccgggcgctggagaat
atcggggtagcactggaacacggcctcagggttttcgacgcctccgccggcgggctcggc
ggctgtccctatgcaccgggcgcggccgggaatgtcgattcactcgaggtccgcgcgttt
ctcgaaacgcggggttttaacaccgggctcgaccttgaaaagctcgatcgcgcgggtgca
tttgcacgatccttgaggagcgcagcatga

DBGET integrated database retrieval system