KEGG   Sinorhizobium medicae: Smed_4538Help
Entry
Smed_4538         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI_p1: 
UniProt: 
Position
pSMED01:1026227..1026598
Genome map
AA seq 123 aa AA seqDB search
MMAVEFQIAAARFGDDHSPFLSARLVADRLGVTLAELAKLIGVARNTLTAKSGARKVDSA
LSRVVRILAMASEMAGDESRAVIWFKHQPIPGWAGKTAFDLVGEGKADKVLAYLESVRAG
VYA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgttgagtttcagatagccgctgcgcgtttcggggacgatcactccccattt
ctttcggctcgccttgtcgccgatcggctgggcgtcacgcttgccgaactcgcaaagctg
atcggcgttgcccggaatacgctgacggcgaaatccggcgcccgaaaggtcgatagtgct
ttaagcagggtggtgcgcattctggcgatggcttccgaaatggcgggcgacgagagccgc
gccgtcatttggttcaagcatcagcctatccccggctgggccggcaagacggcgttcgat
ctcgtcggagagggcaaggccgacaaggtgctcgcctatctcgaatccgttcgcgccggc
gtctacgcctga

DBGET integrated database retrieval system