KEGG   Sinorhizobium medicae: Smed_4563Help
Entry
Smed_4563         CDS       T00555                                 

Definition
(RefSeq) carbamoyl phosphate synthase-like protein
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
smd  Sinorhizobium medicae
Pathway
smd00240  Pyrimidine metabolism
smd00250  Alanine, aspartate and glutamate metabolism
smd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Smed_4563
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Smed_4563
Enzymes [BR:smd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     Smed_4563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATPgrasp_Ter ATP-grasp_3 Dala_Dala_lig_C CPSase_L_D2 ATP-grasp_4 TTL RimK
Motif
Other DBs
NCBI-GeneID: 5319231
NCBI-ProteinID: YP_001313296
JGI_p1: Smed4563
UniProt: A6UI83
Position
pSMED01:1050578..1051570
Genome map
AA seq 330 aa AA seqDB search
MKVFITGAGALLGQGIIRALRRSTLNARIIVGDPSPLSAGLYWGDAAYLVPMAKDPSYLD
RLGELLRAERPEVLIPGTDVELPILAANRDAIERTYGTKVIISSPRVVSIANDKWLTSEF
FRERGLGYVPSCLPGDEDALIEECGFPLIVKPRVGARSIGFSVVRNREQLMRAIEEQPGI
VIQKYVGAETTEYTAGTLTFDGKCRATIVMRRDLRDGNTYRAFAEPFPALNKAMAEAADA
LGAYGPANFQFRLDDGVPRIFEINARFSGTTAVRIHAGFNEVEMCIRHLLFEEPVEQPQI
TPVTILRHWSETVVKPGELVTASSKLDETV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctttataaccggggcgggtgccttgctcgggcaaggcatcattcgcgccctg
cggcgctcgactttgaatgcgaggatcattgtgggggacccgagcccgctctcggcaggg
ctgtactggggggatgccgcctatctcgtgccgatggccaaggacccttcatatctggac
cggcttggggaactcctgcgtgccgaacggcccgaagtcctcattccggggaccgacgtc
gaacttccgatcctcgccgcgaacagggatgcgatcgagagaacctacggaaccaaggtg
atcatcagctcgccgcgggtggtgtcgatcgcgaacgacaagtggctcacctccgagttc
tttcgcgagcgcggcctgggatatgttccctcctgtctgccgggcgacgaagacgctctg
attgaggagtgcggatttccgctcatcgtcaagccgagagtgggggcgcgttcgatcggt
ttcagcgtcgttcgcaaccgcgagcaactgatgcgtgcaatcgaggagcagcccggcatc
gtcattcagaaatatgtcggtgccgaaaccaccgagtacactgccggcacgctgacattc
gacgggaaatgccgcgcgacgatcgtcatgcgcagggaccttcgcgacggtaatacctac
agggcattcgccgagcctttcccggcgctgaacaaggctatggcagaagctgccgatgcc
ctcggcgcctatggcccggcgaacttccagtttcgtctggacgacggtgttccccgcatc
ttcgagatcaatgctcggttctccgggacgacggcggtcaggatccatgcgggcttcaac
gaggtggagatgtgcatccgccatctcctgttcgaggagcccgtcgagcagccgcagatc
accccggtgacgatattgcggcactggtccgaaaccgtggtgaagcccggtgaactggtg
acggcttcttcgaaactcgacgaaacggtgtga

DBGET integrated database retrieval system