KEGG   Sinorhizobium medicae: Smed_4577Help
Entry
Smed_4577         CDS       T00555                                 

Definition
(RefSeq) polysaccharide biosynthesis protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_3 Polysacc_synt_C
Motif
Other DBs
NCBI-GeneID: 5318024
NCBI-ProteinID: YP_001313310
JGI_p1: Smed4577
UniProt: A6UI97
Position
pSMED01:complement(1070114..1071472)
Genome map
AA seq 452 aa AA seqDB search
MAFRKKLFKKIGGLRQILSRERTLLERLQSIAHLLTGNILSSVIGLIGFALTARALGPAG
YGILALCFSYTRAVERIVSFQSWQPLIKYGAHSLSDNADDFKEMQSLLKFGLLLDVSAAL
AGWLIAVLFILLASPWLGISEDGASLAILYCTVLPFQVSGMPTAVLRLYGRFMAIAYGQV
ATSVLRVALCAIGVATGAGLFEFTLIWMSAQIIGTLVLVLFALAELRRQGILSGLLSAPL
RGITARFPGLWKFAISANLSLTIRSSANELDTLLVGYLADPTSAGLYHIAKRIGRIAQQA
GVQVQAVLYPELARAWAAKALGAFHRAVAQMQALLLACGLFLIGGLYLLIGPLLSWAAGP
EFAAAGPLVIVQSIAVTMTLCGAVIRSALLAMGRENEILRSVTIAAIGFHATAFALIPTM
GAMGANVAHIVMASIWLSTMMLSYRRTPAPGP
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttccgaaaaaagcttttcaagaaaatcggcggcttgcgacaaattctcagtcga
gagagaacgctgctcgagcgcctgcagagcattgcgcatctgctcaccggaaacattctg
agctcggtgatcggcctcatcggctttgccctcacggcgagggccctcggcccggcgggc
tatggcattctcgcgctgtgtttctcctatacgcgcgcggtcgagaggatcgtaagcttc
cagtcctggcaaccgctgatcaaatacggcgcgcactcgctctcggataacgccgatgac
ttcaaagaaatgcagtccttgctcaaattcgggctgctgctcgatgtttctgcggcgctc
gccggatggctgatcgccgtcctgttcatcctgttggcctcaccctggctcgggatctcg
gaggacggagcgagccttgccatactctactgcacggtgctgccattccaggtatccggc
atgccgacggccgttttgcgcctttacgggcgcttcatggcgatcgcctacggccaggtc
gccacaagcgtccttagggtggctctttgcgccatcggcgtcgccacgggcgccggcctg
ttcgaattcacgctcatctggatgtcggcgcagatcatcggcaccctcgttctcgtgctt
ttcgcgctggccgaactgcgccggcaaggtatcctctcgggcctgctgagcgccccgctt
cgcggcattaccgcccggtttccggggctttggaagtttgcgatctcggcgaacctgtcg
ctcaccatccgttcgagcgccaacgagctcgacacgctgctcgtcggctatctcgccgat
ccgacttccgccggactctatcacatcgctaaacgcatcggccgcatcgcgcagcaggcc
ggggtgcaggtacaggccgtcctttatccggaacttgcccgggcatgggccgccaaggcg
ctcggcgcctttcatcgggcagtcgcacagatgcaggcgcttctcctcgcctgcggcctc
tttctgatcggcggcctctatctccttatcggccctctcctctcctgggccgccggcccg
gagttcgcggccgccggcccactcgtgatcgtgcagtcgatcgccgtcacgatgaccctg
tgcggcgccgtcatccggtcggcgcttctggcaatgggacgtgagaacgagatattgcgc
agcgtcacgatcgccgcgatcggttttcatgcgactgcattcgctctcattccgaccatg
ggcgccatgggagcgaatgtcgctcatatcgtcatggcttcgatctggttgtcaacgatg
atgctgagctaccgtcgcaccccggcgccagggccttga

DBGET integrated database retrieval system