KEGG   Sinorhizobium medicae: Smed_4653Help
Entry
Smed_4653         CDS       T00555                                 

Definition
(RefSeq) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
smd  Sinorhizobium medicae
Pathway
smd00511  Other glycan degradation
smd00520  Amino sugar and nucleotide sugar metabolism
smd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Smed_4653
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Smed_4653
Enzymes [BR:smd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Smed_4653
Chaperones and folding catalysts [BR:smd03110]
 Intramolecular chaperones
  Others
   Smed_4653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b E3_binding
Motif
Other DBs
NCBI-GeneID: 5318816
NCBI-ProteinID: YP_001313383
JGI_p1: Smed4653
UniProt: A6UIH0
Position
pSMED01:1161201..1163120
Genome map
AA seq 639 aa AA seqDB search
MLQAAYRLESAWQPDGGPFGRFTFSLFNLSGEPLSDFRLVYTSLTRVIDPDACENAVFLR
RNANFHEFAPPEGLTLAHGEHWTFMISGLHRQAKHCTDGAKSAYLTLADGSHVAVAVSDL
RLEGAVSEPPPERLPEGWLDLPFALQPWPAEIDAAPGDLLPDFLYPAAGSAADEIEAVSN
VLALFHRLFSAGHAPFSLAPSSQGRPIMFKKAAELGGEAYRLHFSDEEIRLDYGAAAGRQ
YGLTSLAQLIDGARNHAGSFSFPVSGVIADGPRYGWRGCHLDVSRQFYPTADILRLIDIL
AWFKLNIFHWHLTDDEAWRLEIKAYPTLTTLGVMRGPDEPMLPQLGNGAEPVGGFYSQEE
AKAIVAHAAALSIEVVPEIDIPGHSTAALVAIAELSDGQEAPESYHSVQGYPNNALNPAI
PLTYEFLEKVFDEMVELFPSRYIHVGGDEVADGSWLASPLARKLMEQEGISGTFALQSYF
LKKVKQMLTARGRKLVGWNEVAHGGGVGTKDTLLMAWENPKVGIELAREGYDVVMTPGQA
YYLDMAQADAWQEPGASWAGTATPSHTYAYEAEGEFPKELKSRMKGVQACIWSEHFLSRG
YFNRLVFPRLPAIAEAAWTPKDKKDWLRFAAIAPLSPVL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggccgcttatcgccttgaatctgcctggcaaccggatggtggcccattcggg
cgcttcaccttcagcctctttaacctttcgggcgagccgcttagcgactttcggctcgtc
tacacgtcgctcacccgcgtcatcgatccggacgcatgcgagaatgcggtcttcctccgc
aggaatgccaatttccacgagttcgcgccgcccgaaggactgacgcttgcccacggagag
cactggacattcatgatcagcggtctgcaccggcaggcgaagcattgcaccgacggggcg
aagtcggcctatctgacgctcgccgatggaagtcatgtcgctgtggcggtttccgacctt
cgtctggagggcgccgtaagcgagccgccgccggagcgcctccccgaaggctggctcgac
cttcctttcgcgctgcagccctggcccgcggagatcgatgcagcgcccggagacctgctt
ccggatttcctctatcctgcggcgggaagcgctgcggacgagatcgaggcggtctccaac
gtactcgcgctcttccacaggctgttttcggcgggtcacgctccattcagccttgcgcct
tcctcccaggggcggccgatcatgttcaaaaaggcagccgagctcggcggagaagcctac
aggcttcatttttccgacgaggagatccggctcgactatggagctgccgccgggaggcaa
tacggcctgacgtccctcgcccaactgatcgacggtgcccgcaaccacgccgggagtttc
agttttccggtatccggtgtaatcgcggacgggccgcgctacgggtggcgcggctgtcat
ctcgatgtgtcgcggcaattctatccgaccgccgacattctgcgcctcattgatatcctc
gcctggttcaagctcaacatcttccattggcacttgaccgatgacgaagcctggcggctt
gaaatcaaggcctatccgacgctcacgaccctgggcgtcatgcgggggccggacgagccg
atgctgcctcagctcggcaacggcgccgaaccggtcggcggcttctacagccaggaggaa
gcaaaggcgatcgtcgcgcatgctgcggcgctcagcatcgaagtcgttccggagatcgac
attcccggacacagcactgccgcgctcgtggcgattgccgaactctccgatggacaggag
gcgccggaaagctaccattcggtccagggctatcccaacaacgcccttaaccctgccatt
ccgctcacctacgaattcctcgagaaggtgttcgacgaaatggtcgagctcttcccgagc
cgatatatccatgtcggcggtgacgaggtggcagacggttcgtggctcgcttcgccgctg
gcgcgaaagcttatggaacaggaaggcatttccggcaccttcgcactgcagtcctatttc
ctaaagaaagtgaaacagatgctgacggcgcgaggccgcaagcttgtcggctggaacgag
gttgcccatggcggcggggtcggaacaaaggacacgctgctgatggcttgggagaacccc
aaggttgggatcgagctggcacgcgagggttacgacgtcgtgatgacgcccggccaggcc
tattatctcgacatggcccaggcggatgcctggcaggaacccggtgccagctgggccggc
acggcaacgccgtcgcacacctacgcctatgaggcggaaggggagttcccgaaagagctg
aagagccgcatgaagggcgtccaggcctgcatctggtccgagcatttcctctcgcgggga
tatttcaaccgcctcgtctttcccaggctgccggcaattgccgaggcggcctggacgccg
aaggacaagaaggattggttgcgctttgccgcgatcgcgccattgagtcccgttctgtga

DBGET integrated database retrieval system