KEGG   Sinorhizobium medicae: Smed_4653Help
Entry
Smed_4653         CDS       T00555                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
smd  Sinorhizobium medicae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Smed_4653
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Smed_4653
Enzymes [BR:smd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Smed_4653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p1: 
UniProt: 
Position
pSMED01:1161201..1163120
Genome map
AA seq 639 aa AA seqDB search
MLQAAYRLESAWQPDGGPFGRFTFSLFNLSGEPLSDFRLVYTSLTRVIDPDACENAVFLR
RNANFHEFAPPEGLTLAHGEHWTFMISGLHRQAKHCTDGAKSAYLTLADGSHVAVAVSDL
RLEGAVSEPPPERLPEGWLDLPFALQPWPAEIDAAPGDLLPDFLYPAAGSAADEIEAVSN
VLALFHRLFSAGHAPFSLAPSSQGRPIMFKKAAELGGEAYRLHFSDEEIRLDYGAAAGRQ
YGLTSLAQLIDGARNHAGSFSFPVSGVIADGPRYGWRGCHLDVSRQFYPTADILRLIDIL
AWFKLNIFHWHLTDDEAWRLEIKAYPTLTTLGVMRGPDEPMLPQLGNGAEPVGGFYSQEE
AKAIVAHAAALSIEVVPEIDIPGHSTAALVAIAELSDGQEAPESYHSVQGYPNNALNPAI
PLTYEFLEKVFDEMVELFPSRYIHVGGDEVADGSWLASPLARKLMEQEGISGTFALQSYF
LKKVKQMLTARGRKLVGWNEVAHGGGVGTKDTLLMAWENPKVGIELAREGYDVVMTPGQA
YYLDMAQADAWQEPGASWAGTATPSHTYAYEAEGEFPKELKSRMKGVQACIWSEHFLSRG
YFNRLVFPRLPAIAEAAWTPKDKKDWLRFAAIAPLSPVL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggccgcttatcgccttgaatctgcctggcaaccggatggtggcccattcggg
cgcttcaccttcagcctctttaacctttcgggcgagccgcttagcgactttcggctcgtc
tacacgtcgctcacccgcgtcatcgatccggacgcatgcgagaatgcggtcttcctccgc
aggaatgccaatttccacgagttcgcgccgcccgaaggactgacgcttgcccacggagag
cactggacattcatgatcagcggtctgcaccggcaggcgaagcattgcaccgacggggcg
aagtcggcctatctgacgctcgccgatggaagtcatgtcgctgtggcggtttccgacctt
cgtctggagggcgccgtaagcgagccgccgccggagcgcctccccgaaggctggctcgac
cttcctttcgcgctgcagccctggcccgcggagatcgatgcagcgcccggagacctgctt
ccggatttcctctatcctgcggcgggaagcgctgcggacgagatcgaggcggtctccaac
gtactcgcgctcttccacaggctgttttcggcgggtcacgctccattcagccttgcgcct
tcctcccaggggcggccgatcatgttcaaaaaggcagccgagctcggcggagaagcctac
aggcttcatttttccgacgaggagatccggctcgactatggagctgccgccgggaggcaa
tacggcctgacgtccctcgcccaactgatcgacggtgcccgcaaccacgccgggagtttc
agttttccggtatccggtgtaatcgcggacgggccgcgctacgggtggcgcggctgtcat
ctcgatgtgtcgcggcaattctatccgaccgccgacattctgcgcctcattgatatcctc
gcctggttcaagctcaacatcttccattggcacttgaccgatgacgaagcctggcggctt
gaaatcaaggcctatccgacgctcacgaccctgggcgtcatgcgggggccggacgagccg
atgctgcctcagctcggcaacggcgccgaaccggtcggcggcttctacagccaggaggaa
gcaaaggcgatcgtcgcgcatgctgcggcgctcagcatcgaagtcgttccggagatcgac
attcccggacacagcactgccgcgctcgtggcgattgccgaactctccgatggacaggag
gcgccggaaagctaccattcggtccagggctatcccaacaacgcccttaaccctgccatt
ccgctcacctacgaattcctcgagaaggtgttcgacgaaatggtcgagctcttcccgagc
cgatatatccatgtcggcggtgacgaggtggcagacggttcgtggctcgcttcgccgctg
gcgcgaaagcttatggaacaggaaggcatttccggcaccttcgcactgcagtcctatttc
ctaaagaaagtgaaacagatgctgacggcgcgaggccgcaagcttgtcggctggaacgag
gttgcccatggcggcggggtcggaacaaaggacacgctgctgatggcttgggagaacccc
aaggttgggatcgagctggcacgcgagggttacgacgtcgtgatgacgcccggccaggcc
tattatctcgacatggcccaggcggatgcctggcaggaacccggtgccagctgggccggc
acggcaacgccgtcgcacacctacgcctatgaggcggaaggggagttcccgaaagagctg
aagagccgcatgaagggcgtccaggcctgcatctggtccgagcatttcctctcgcgggga
tatttcaaccgcctcgtctttcccaggctgccggcaattgccgaggcggcctggacgccg
aaggacaagaaggattggttgcgctttgccgcgatcgcgccattgagtcccgttctgtga

DBGET integrated database retrieval system