KEGG   Sinorhizobium medicae: Smed_5119Help
Entry
Smed_5119         CDS       T00555                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
smd  Sinorhizobium medicae
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:smd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Smed_5119
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Smed_5119
Enzymes [BR:smd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Smed_5119
Two-component system [BR:smd02022]
 CheA family
  CheA-CheYBV
   Smed_5119
Bacterial motility proteins [BR:smd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Smed_5119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p2: 
UniProt: 
Position
pSMED02:72801..73832
Genome map
AA seq 343 aa AA seqDB search
MVRILLVASTHEVEELVKKAIESDASAELLLTARSGKDAVRMTGELLPDIVAVELCPSGD
DSAKTVREIMISAPTPVVMLASRDGSQLGTASAQALEAGALAVIPAPGAHGTALDAPAIE
KFLSTVKAMSQVKIVRQWRRKDHGSKDRTAPAASAAIGIVAIAASTGGPAALRSILKEIS
ADFPVPILIVQHMSNGFIDGVAASLDATVPPTVKVARNGELLRPGTVYFAPDNYQLGVSG
RSRLRISDDAPVNGFKPSGSYLFGSIARVFKGESLAVILTGMGDDGTEGLRSLRVAGGKA
IAQDEKSSVVFGMPKSAIGAGLVDLVLPLESIAENITAIARGR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggtccgtattcttctcgtcgcatccacacacgaagtcgaagagctcgtaaagaaggcg
atcgagagcgacgcctccgcagagctcttgctgaccgcgagaagcgggaaagacgccgtg
agaatgaccggcgaactcttgccggacatcgtcgccgtggaactctgcccctccggcgat
gatagcgctaaaacggtcagggaaataatgatctccgcacctacgccagtcgtgatgctc
gcctcccgggacggctcgcaactcggaaccgcttcggcacaagcgctcgaagcgggcgct
ctcgcggtcatacccgcgccgggggcccacggcacggctctcgatgccccagcgatcgaa
aagtttctctccacggtcaaggccatgtcccaggtcaaaatcgtgcggcaatggcgccgg
aaggatcacggatccaaagaccgaaccgcgcccgcggccagcgcggcgatcggaatcgtc
gcaatcgcggcctctaccggcggcccggctgcgctccgttcgatactgaaggaaatttca
gccgatttcccggttcccattctcatcgtccagcacatgtcgaacggctttatcgatggc
gttgccgcctctcttgacgcgaccgttccacctacagtgaaggtcgccaggaatggagag
cttcttagacctggcacggtctacttcgcgccggacaattatcagctcggcgtctccggc
agatcgcgcctacgcatctcggacgatgctccggtcaacggcttcaaaccctctggatcc
tacctcttcggctcgattgcacgtgttttcaaaggagaatcccttgcggtcatcctgacg
ggaatgggcgatgacggaaccgaggggcttcggtcactgcgtgtggcgggcggcaaggcg
atcgcccaggacgagaagagctcggtcgtcttcggcatgccgaagtcggcgatcggcgcc
ggcctcgtagaccttgtgctgccactggaaagcatcgccgagaacattacggccatcgcc
cggggtcgctag

DBGET integrated database retrieval system