KEGG   Sinorhizobium medicae: Smed_5137Help
Entry
Smed_5137         CDS       T00555                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
smd  Sinorhizobium medicae
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Smed_5137
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Smed_5137
Enzymes [BR:smd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Smed_5137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p2: 
UniProt: 
Position
pSMED02:90008..91447
Genome map
AA seq 479 aa AA seqDB search
MSTASFFSDMLQGIADRGRRFLSLGPARNGEADAVGTMQALCETLLSSRGEASGMALAKN
ILDRWQGFDPEKRRDFMIALLSHFGPDIERLERAIDSYRADPTPKALHEMSMAAEPRRQE
LIRRLNLAPNGIATLVRMREDLLELKARNPDLEAVDTDFAHLFGSWFNRGFLVLRPISWS
TPADILEKIIRYEAVHYIGGWDELRRRLAPEDRRCFAFFHPQLADDPLIFVEVALTREMP
SNIADLLKEDRAPIRAADATTAVFYSISNCQEGLRGISFGNFLIKQVVEDLRRDLPRLDT
FATLSPVPGFADWLSRERRAEASDALSQADRGKLALLDEPDWADQPEIVASIQPNLSAAA
GWYFLRARNSSGKVADPVARFHLGNGARLERINFLGDRSERAMRQAHGLMVNYLYKLDDI
ETNHEAFATRGEVVAAPAIRRLVPADRSPRSLVPVPDILSPDARSSDAPGRKGNKEFTS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcatcattctttagcgacatgctgcagggcattgccgaccgcggccggcgc
tttttatcgctcggtcccgcccgtaatggcgaagccgatgcggtcggcaccatgcaggcg
ctatgcgagaccctgctgtcgagccgcggcgaagcttcaggcatggcgttggccaagaat
attctggatcgctggcaaggcttcgatccggaaaagcggcgcgatttcatgatcgcgctg
ctctcgcacttcgggcctgatatcgaacggttggagcgggcgatcgactcctaccgcgcc
gatccgacgccgaaggcgctgcatgaaatgagcatggcggcagaaccgcgtcgccaggag
ctgatccgcagactgaatcttgcccctaacggcatcgcgacgctcgtccgcatgcgggag
gacctcctcgaactcaaagcccgcaaccccgatctggaggcggtcgacacagacttcgct
catctcttcggatcctggttcaatcggggctttctcgtgctgcggccgatcagctggtcg
acgccggccgatatactggagaagatcattcgatacgaagccgtccactatatcggcggc
tgggacgagctgcgccgccggcttgccccggaggaccgccgttgcttcgcctttttccac
ccacagctcgccgatgacccgttgatcttcgttgaagtggcgctgacacgcgaaatgcct
tcgaacatagcggaccttttgaaggaggatcgcgccccgatccgcgcggccgacgcgacg
acggcggtcttctactccatttcgaactgccaggagggcctcaggggcatttccttcggc
aatttcctgatcaaacaagtggttgaggatctgcggcgcgatcttccccgcctcgacact
ttcgcgacgctgtcgccggtgccgggatttgccgattggttgtcgcgtgaacggcgggca
gaagcgtccgacgccctctcgcaggccgaccggggcaagctcgctctgctcgacgaaccg
gattgggccgatcaacccgagatcgtggcaagcattcagccaaacctgtcggctgcggct
ggctggtatttcctcagagcccgcaacagctccggcaaggttgcggatcctgtagcgcgg
ttccacctcggcaacggcgcgcggctcgaacgcataaatttcctgggcgaccgttccgaa
cgggcgatgcgccaggcccacgggctcatggtcaactatctctacaagctcgatgacatc
gagaccaaccacgaagcctttgccacgcgcggcgaggtggtcgccgcacccgccattcgc
cgcctggttcccgcagataggagtccacgcagcctcgttccggttcccgacatcctttcc
ccggatgcccggtcgagtgatgcaccggggcggaaaggcaataaggagttcacttcatga

DBGET integrated database retrieval system