KEGG   Sinorhizobium medicae: Smed_5210Help
Entry
Smed_5210         CDS       T00555                                 

Definition
(RefSeq) cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
smd  Sinorhizobium medicae
Brite
Enzymes [BR:smd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Smed_5210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI_p2: 
UniProt: 
Position
pSMED02:172393..173427
Genome map
AA seq 344 aa AA seqDB search
MKPLVVLMLLLLAYPTHAQEPATVEATAWQKYKTRFLDPGGRIIDDANGDISHSEGQGYG
LLLAFLAGSRADFELIWSFTRRELLLRDDGLAAWKWSPGEAPHVSDTNNATDGDILIAYA
LARAGVSWDRKDYTRAATALAEAILEKTVVEHGGLTLLLPGAQGFSAADRADGPVINPSY
WVFEAFPVLEQLVPSPAWKALAADGEAILKRLEFGPKKLPADWISARTVFKPAEGFPSEY
GYNALRIPLYLVRSGRTDSELLSRIYRGMSDAKGAVLLSDVESGAVEETLTDPGYRIINH
ILACVLQGTKLPDDMKTFEPTQYYPSTMHLLGLSFVEEMRPECL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagccactcgtcgtgctaatgctcctgctgctagcttatccgacgcatgcccaggag
ccagcgacggtggaagcaacggcgtggcaaaagtataagacgcgatttctcgatccgggc
ggccggattatcgacgacgccaacggtgatataagccatagcgagggacagggttacggc
cttctgttggcctttctcgcgggcagccgggccgattttgaactcatctggtcgttcacg
cgccgcgaactcctcctgcgcgacgacggccttgcggcctggaaatggagtccgggcgaa
gcgcctcatgtttccgatacgaacaatgcaacagacggcgacatattgatcgcctatgcc
ttggcccgtgcaggggtttcctgggatcgcaaggactacacgcgtgcggctactgcgctg
gcagaggcgattctcgagaaaaccgtcgtcgaacatggggggctgaccttgctcttgccg
ggcgcgcagggattttctgcggccgatcgggccgacgggcccgtcatcaacccgtcctac
tgggttttcgaagcctttccggttctcgaacaattggttccttctcctgcctggaaagcg
ctcgcagcggacggtgaagctattctcaagagactggagttcgggccaaagaagttgccc
gccgactggattagtgcacgaaccgtgttcaagccggcggagggcttcccgtccgaatac
ggctataacgcgctgcgcatcccgctttatcttgttcgctcgggaaggacagacagtgag
ctcctttcacggatctacaggggcatgtccgacgcgaaaggtgcggttttgctcagcgat
gtcgaaagcggtgccgtggaggagacccttaccgatccaggttatcgaattattaaccat
atcctggcctgtgtcctccaagggacgaagctccccgacgacatgaaaacgtttgaaccg
acccaatactatccctcgacaatgcacctgctgggtttgtctttcgtggaggaaatgcgt
ccggagtgcctatga

DBGET integrated database retrieval system