KEGG   Sinorhizobium medicae: Smed_5245Help
Entry
Smed_5245         CDS       T00555                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
smd  Sinorhizobium medicae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:smd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p2: 
UniProt: 
Position
pSMED02:complement(207720..208643)
Genome map
AA seq 307 aa AA seqDB search
MPTLPYAILEAPSTLGLATDGVEHLPDQLLGLGLAERIHARRADRLAVLPKEPAPDAETG
ILNTRAIAAWSPKLADAVEAVVDSGEFPVVLGGDCTIVLGSMLAFRRRGRYGLFFIDGNA
DFFQPEAEPNGEGASMDLALVTGYGPSHLTDIEGRSPLVRPEDAVAFAYRDHKDQEEYGS
QPLPKELKAIDLPAVRAMGIEAAARKAVDHLTREALDGFFIHLDADCLDDVVMPAVDFRV
PGGLSWDELGVALRVALASGKAVGIEVTIYNPRLDADGSAGRGLADVLAAALGTAAPRVD
RRRADIR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccttccctatgcgattctcgaagccccctctacactgggcctcgcgaccgac
ggtgtggagcacttgcccgaccagctcctgggcctcggtcttgcggagcgcatccatgcg
cgccgcgccgatcggctggcggtgcttccgaaggagccggcgcctgatgccgagactggc
atcctgaataccagggcaattgcggcgtggtctcccaagctcgccgacgcggtggaagcg
gtggttgactcgggcgaatttccggtagtgctcggcggggattgcacgatcgtgctgggc
tcgatgctcgcgtttcgacggcgcggccgttacggcctgttcttcatcgacggcaacgcc
gatttcttccaacccgaggcggaacccaatggtgagggcgcctcgatggaccttgccctg
gtcaccggctacggcccgtcgcacctgaccgacattgaaggtcgcagtcctctggtccgt
cccgaagacgctgtggcgttcgcgtatcgcgaccataaggatcaggaggagtacggaagc
cagccgctccctaaagagctcaaggcgatcgaccttcccgccgtgcgcgcgatgggcatc
gaggccgccgcgcgcaaagcggtcgaccacctgacccgagaggcattggacggcttcttc
atccatctcgacgcggattgcctcgacgacgttgtcatgccggctgtcgatttccgcgtt
ccgggcggtttgtcgtgggacgagctaggggtcgcacttcgggttgccttggcgagcggc
aaggcggttggcatcgaggtcaccatttacaatccacgtcttgatgcggacggcagcgcc
gggcgcggcctggccgatgtactagcggcagcgctcggaactgcagcgccccgggtcgat
cgccgaagggcggatatccgataa

DBGET integrated database retrieval system