KEGG   Sinorhizobium medicae: Smed_5437Help
Entry
Smed_5437         CDS       T00555                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
smd  Sinorhizobium medicae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p2: 
UniProt: 
Position
pSMED02:395591..398272
Genome map
AA seq 893 aa AA seqDB search
MALHPGFPNDPHTVLDPSIRWFPADEAMRETSMDKLMPPLVAALRQKVKDFRDGGYVGAT
DTSRSLLNWWFNTPHLIPQTDGNMTEFQYFFAQRESLETIIYLYDVVGVNDKFDLMRFDS
SGAVSANMFDETWRRFVVKMATGAGKTKVLSLALAWSFYHKLYEPDSRLARNFLVIAPNI
IVLDRIYKDFQGLRLFFDDPVIPDNGFDGRNWRDDFQLTLHVQDEVRITHPTGNIFLTNI
HRVYGGEDIPASPEDDNSMDYFLGTRPTGATTDSQVDLGMIVRDIDELMVLNDEAHHIHD
SRLAWFKSIEDIHNRLLQKGSALSLQVDVTATPKHNNGAIFVQTVADYPLVEAISQNVVK
HPVLPDAASRAKLSERQSAKYTEKHADYIDLGVIEWRKAYAEHEKVGKKAILFIMTDDTR
NCDDVADYLEGNYADLKGAVLVIHTKANGEISESTSGKAKEELEKLRKQANEIDDAASPY
KAIVSVLMLKEGWDVRNVTTIVGLRAYTSKSNILPEQTLGRGLRKMYPGGIEEYVSVVGT
DAFMEFVESIQAEGVELERQAMGQGTKPKTPLVIEVEKDNEKKDIDALDIEIPVMTPRSY
REYKSLGDLDITAFAHQRVPYRTFSEEQQREIVFKDITTGAITHTTILDTAGIADYRSVL
GYFAQTVMKELRLISGYDILYGKIKAFVQSELFDCEVDLDSANTLRNLSELSATKTLIEN
FKKAINALTVKDKGDAEIRDTIKLRQTRPFVTKEQGYLVPKKSVFNRIIGDSHLELIFAS
FLESCSDVVAYGKNYLAVHFKIDYVNAEGNISNYYPDFLVKLPDKRTVIVETKGLEDSDV
PLKMERLKQWCEDINRVQADVTYDFVYVDQESFEKYSPKSFSELVENFTQYKV
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggcattgcatccaggctttcccaacgatccgcacaccgttctcgacccttcgatccga
tggtttccggccgacgaggcaatgcgcgaaaccagcatggacaagcttatgccgccgctc
gtggcggcgctgcgccagaaggtgaaagacttccgtgacggcggttatgtcggcgcgacc
gataccagccggagcctgctcaattggtggttcaatacgccccacctaatcccccagact
gacggcaacatgactgagtttcagtatttcttcgcacagagggaatccctggaaaccatt
atctatctttatgatgttgtcggcgtgaacgacaaattcgacctaatgcgcttcgacagt
agcggggccgtttccgccaacatgttcgatgaaacatggcgtcgtttcgttgtgaaaatg
gcgacaggggcggggaaaaccaaggtgcttagtctggccctggcatggagcttctaccac
aagctctacgagcccgactcccggctggcccgcaacttccttgtgattgcacctaacatc
atcgtgctggaccgcatctataaggacttccagggactgcggttgtttttcgacgacccg
gttatccccgataacggctttgatggccgtaactggcgcgatgatttccagttgacgctg
catgtgcaggacgaggtgcgtatcacgcatccgaccggcaacatctttctcaccaacatt
caccgggtttatggaggcgaggacatccctgcatcgccagaagacgacaactcgatggat
tatttccttggcacccgaccgaccggcgcgacgacggattcccaggtggacctcggtatg
atcgtccgtgacatcgatgaactgatggtgctcaacgacgaggcccatcacattcacgac
tcgcggctcgcatggttcaagtcgattgaggacatccacaaccgactgttgcaaaaaggg
tctgccctatcgctacaagtagacgtgacggcgaccccgaagcacaacaacggcgcgatc
ttcgtgcagaccgtggccgattatccgctagtcgaagccatttcgcagaatgtcgtgaag
catcccgtgctgccagacgctgccagccgagccaagttgtccgagcgacagagcgccaaa
tacaccgagaaacacgctgactatattgacctcggggtgatcgaatggcgcaaggcctat
gccgaacacgagaaggtgggcaagaaagccatcctgttcatcatgactgacgacacgcgc
aactgcgatgatgttgcggactatcttgaaggcaactacgccgatctcaaaggcgcagtg
ctagtcattcacaccaaagccaacggcgaaatctccgaatccacctcaggcaaggccaag
gaagaactggaaaagctcaggaagcaggcgaacgagatcgatgacgccgccagcccctac
aaggccattgtatcggtcctgatgctgaaagaggggtgggacgtacggaatgtgactacc
attgtcggactacgggcctatacctcgaagagcaacattctccccgaacagacgctgggg
cgtggcctccgcaagatgtatcctggtggcatcgaagagtatgtcagtgttgttggcacc
gacgcctttatggagtttgtcgagtccatccaagccgagggcgtcgagcttgagcgccag
gcgatgggccaggggacgaagccgaagacccccctcgtgatagaggtggagaaagacaac
gagaagaaggacatagatgccctagatatcgagattccggtgatgaccccacggagctac
cgcgagtacaagtcactgggcgaccttgatataacggcctttgcccatcagcgcgttcct
taccgaactttcagcgaggagcaacagcgcgagattgtgttcaaggacatcacgactggc
gcgataacgcacaccaccatactcgacacggcaggaattgccgattaccgcagcgtcctg
gggtatttcgcccagaccgtcatgaaggaattgcggctgatcagcggctacgacattctt
tacgggaaaatcaaagccttcgtgcagtcggaattgtttgactgcgaagttgacctcgac
agcgccaacaccttgcggaatctatccgaattgtccgcgacgaaaacgcttatcgaaaat
ttcaagaaagccatcaacgccctaacggtaaaggacaagggcgacgcggaaatccgcgac
actattaagctgcggcagacccggcccttcgtgacaaaggagcagggctatctagtgccg
aagaaaagcgtcttcaaccggattattggcgacagccatcttgaactaatttttgccagt
ttccttgagtcctgctccgatgtggttgcttatggaaagaactacctcgcagtgcatttt
aagattgattacgtcaacgccgaagggaatatctccaactactatcccgactttctggtg
aagctacctgacaagcggactgtgatcgttgaaaccaagggtcttgaggactcagacgta
ccgctgaagatggagcgtctgaagcaatggtgcgaggatatcaatcgggtgcaggccgac
gtaacctatgattttgtttacgttgaccaggaaagctttgaaaaatacagtccgaagtca
ttttcggagcttgttgagaatttcacacaatacaaggtgtga

DBGET integrated database retrieval system