KEGG   Sinorhizobium medicae: Smed_5532Help
Entry
Smed_5532         CDS       T00555                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
smd  Sinorhizobium medicae
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:smd00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p2: 
UniProt: 
Position
pSMED02:497144..498175
Genome map
AA seq 343 aa AA seqDB search
MMTDRDPLQSFPRERLMKGPTPIQRLARLEEVLGERSRGVSIWAKRDDLMELGGGGNKLR
KLEFLLGQAKAEGCDTLVVTGGVQSNFARLAAAACARSGLACELVLAQMVPRTTEIYQDN
GNVLLDRLFGASVHILDPDEDAGAYARRRVDEIAETRRRALLAPLGGSTTIGCLGYVDCA
FELARQSAETGVAFEQIIIPNGSGGMHAGLAAGVVVAGSHPSRIAAYTVLSPADKCLLAT
ADKVNAVLERLASDARVTADDLRISSAQLGEGYGMPTSGMIDAVELLARSEGLLVDPVYG
GKALAGLLSDVESGAIAPQSNVLFIMTGGSPGLYAYADVLTSK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgaccgagatcctttgcagagctttccccgtgagcgactgatgaaaggtcca
acgccgatccagcgcttggcgcgtctcgaagaagttctgggcgaacggagtaggggcgta
tcgatctgggccaaaagagatgatctcatggaactcggcggcggcggcaacaagctccgc
aagcttgaattcctcctcgggcaggcgaaagcggagggatgtgacaccctcgtcgtaacg
ggaggagttcaatccaacttcgcacgattggccgccgcagcgtgcgccaggtcggggctc
gcctgcgagctcgttcttgctcagatggtacctcggacgaccgaaatttatcaggacaac
ggcaatgtgcttctcgaccgtctgtttggcgccagcgttcatatactggacccggatgaa
gatgctggcgcgtatgcgaggcgtcgggtcgatgagatcgccgaaactcgcaggagagct
cttctggcgcctctcggcggctcaacgacaatcggttgcctcggttacgtggattgcgct
ttcgaactcgcccggcaatcggctgaaacgggtgttgcgttcgagcagatcatcatcccc
aacggcagcggcggcatgcatgccgggttggctgctggcgtggtcgttgcggggtctcac
ccttctcggatcgccgcatacaccgtgctctcgcctgcagacaagtgtctcctcgcaact
gcggacaaggtcaacgcggttcttgagcgactggccagcgacgctcgcgtgaccgcggac
gatctccggataagcagtgctcaactgggcgaaggatacggcatgccgacttccggcatg
atcgacgcggtcgaacttctcgcgagatcagaagggcttctcgtcgatccggtttacggc
ggcaaggccttggcagggttgctgtccgacgttgaaagtggggcaatcgcaccgcagtct
aacgtgctcttcatcatgaccggaggttcgcccggactttatgcatacgccgacgttctc
acttccaagtag

DBGET integrated database retrieval system