KEGG   Sinorhizobium medicae: Smed_5985Help
Entry
Smed_5985         CDS       T00555                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
smd  Sinorhizobium medicae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Smed_5985
Enzymes [BR:smd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Smed_5985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p2: 
UniProt: 
Position
pSMED02:941255..942697
Genome map
AA seq 480 aa AA seqDB search
MTVAFRSKPVTVEDPAYRGLAIGTYAPAVTPAPAFAQTDLAALSRYYSLLMMRNITSDGY
VIEDPASPGVFSVPGCVIAAPSYPANTPGVDQDYVFNWVRDGAMTAIEIALADLPRVSGG
GVPSLIDYVNFAALCQANAKNSATATLGHACFTITGKVRPWSEQNDGPAIQSIAILTLFG
QLDGATQKIAKRLVETNLSYLLEVYQNKTTNLWEEYEGYSFFARAVQLRFFREISRNTIA
IAVPAGVADAISWLQTQLANHWNGQLYVSVLDVAAQAGYDANIDIVSSVCYGGIHPADTK
LLATAAILRRQWADISSSSYFPINGADAAKGLGPAFGRYPGDHYDGDVAAPVVGGHPWAL
CTANFAEFQYRLANAIDASGAIPLDQFSEPFFAELGLGASSSAADASTALRASSDAMLRA
IVYHSDHYELSEQFDGTTGYEKSVRNLTWSYASFLSAVRARSGGIPAGKNKPRNSRSRSS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgcatttcgcagtaagccagtgacagttgaggacccggcatatagaggtctg
gctatcggcacttatgcgcctgcagtcacaccggcgcctgccttcgcgcagaccgacctg
gctgcattgtcgcgctactattctcttctgatgatgcgcaacatcaccagcgacggctac
gtcatcgaggatccagcatcgcccggcgtcttttcggtaccgggctgtgtcatcgccgcg
ccttcctatccagcgaacacgccgggtgtcgaccaggactatgttttcaactgggtccgc
gacggagctatgacggccatcgagatcgcgcttgccgacttgccgcgcgtttcgggcggg
ggtgtgccgagcctgatcgactacgtgaacttcgccgcgctgtgtcaggcgaatgcgaag
aattccgcgaccgccacacttggccatgcctgcttcaccatcaccggcaaggttcgtccg
tggtcggagcaaaatgacgggccggccattcagtcgatcgccatactgaccttgttcggt
cagttggatggcgccacgcagaaaatcgctaaacgactggttgagactaacctctcttat
cttctcgaagtttaccagaacaagaccacaaatctctgggaggagtatgagggctattcc
tttttcgcaagagccgtacagctgcgctttttccgggagatttccagaaacacgatcgct
attgccgtgcctgccggggtggccgatgccatctcctggctgcaaacccagctggccaac
cactggaatgggcagctctatgtgagcgttctggatgtcgcggcgcaagccggttatgac
gcgaacatcgatatcgtctcttcggtctgctatggcgggatccatccggctgacaccaag
cttctggcaacggcggcaatcctgcggcgccagtgggctgatatttcgtcttcgagctat
ttcccaatcaatggcgccgacgcggccaaagggctcggacccgccttcgggcgctatccg
ggcgaccattacgatggcgatgtggcggctccggtggtcggcgggcatccctgggctctg
tgcaccgccaacttcgccgagtttcaatatcggcttgccaatgccatagacgccagcggc
gccattcctctcgatcagttctccgaacccttcttcgctgaattggggcttggcgcatcc
agcagcgccgccgacgcgtcaactgccttacgcgcttcgtctgacgccatgctgcgcgcc
atcgtctaccacagcgatcactacgaactgagcgagcagttcgatggaaccactggctat
gagaaaagcgtccggaacctgacctggagctacgcctcttttctctcggcagtcagagcc
cgctccggcggtatcccagccggtaagaacaaaccccgaaactcccgcagccgaagttcg
tga

DBGET integrated database retrieval system