KEGG   Sinorhizobium medicae: Smed_6323Help
Entry
Smed_6323         CDS       T00555                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
smd  Sinorhizobium medicae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Smed_6323
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Smed_6323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p2: 
UniProt: 
Position
pSMED02:1237675..1238067
Genome map
AA seq 130 aa AA seqDB search
MKCATMFSTAILGLLLCSSIASAQEHAGPDGERLFRSRCGSCHGLNTGENRVGPHLFGVF
GRAAGSVAGARYSNALRTSGFVWDEERLHAYLNNPRQVVPGTTMSASVRDQAQRSAIITY
LQSLSAEPPN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcgcaaccatgttctcgaccgccatcctcggtctgcttctctgttccagtata
gcctcggctcaggagcatgccggccccgatggcgagaggcttttccgcagccgttgtggc
tcctgtcacggcctgaacacgggtgaaaaccgcgtcgggccgcaccttttcggggttttc
gggcgtgctgcaggcagtgttgcgggcgctcgctactcgaacgcgctccgcacgtccggc
ttcgtctgggacgaggaacgcctccacgcctatctgaacaatcctcgtcaggtcgtgccg
ggtactaccatgagcgccagcgttcgcgaccaggctcaacgctcggccatcatcacatat
ctgcaaagcctttcggcggagccgcccaactag

DBGET integrated database retrieval system