KEGG   Sinorhizobium medicae: Smed_6523Help
Entry
Smed_6523         CDS       T00555                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
smd  Sinorhizobium medicae
Brite
Enzymes [BR:smd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Smed_6523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p3: 
UniProt: 
Position
pSMED03:215640..216422
Genome map
AA seq 260 aa AA seqDB search
MLKVLLILLMSASASASYSQGFPEEPDKVPAQFAISLLEAREANSLGAAPSSAEARSISE
LGLALIIDFEGFVKNGNLHIPYNDAAGYCTIGYGRLIKKERCRDLDLGDLRRGITEEQAV
AFLKEDLSFARLAVQRNTVYDRDSNGDGRKDPIEANNDQFSALVSFIFNVGERNYKRSTL
LRRMQQDRNELAAREFLRWVRADGRIYEGLIARRECEQSLFRSALSFDSDGKFARSNCSS
LGIASTPGDLIDILVGESTP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaaggtcttgcttattttgctcatgtctgcttctgcctctgcctcctatagccag
gggtttcccgaagagccagacaaagttccagctcaattcgcaatttctcttcttgaggca
agggaagccaacagccttggagcggctccgtcttcggctgaggctcgctcgatttcggag
cttgggctcgcccttataattgactttgaagggttcgttaagaacggaaacctccacatc
ccatacaatgatgccgctggctattgcacgatcggctatggacggctgatcaaaaaggaa
cgctgccgcgacctagacctcggagacctgcggcgaggtattactgaagagcaggctgtt
gcgttcctgaaggaagacctctctttcgcacgcctggcggttcaaaggaacacggtttac
gacagggacagcaacggtgacggcaggaaagaccccatagaggcaaacaatgatcagttt
tccgcgctggtatccttcatcttcaatgtaggcgagcgtaactacaagcgttcaacactg
ctacgccgcatgcagcaagatcgaaatgaacttgccgcccgtgagtttctgagatgggtc
cgcgcggacggacggatttatgaggggctaattgcccgaagagagtgcgaacagagtctc
ttcaggagcgcgttgtcattcgacagtgatggtaagttcgcgcgctcgaactgctcgtcg
cttgggatcgcgtccacccctggcgatctgattgacatcctggtcggtgaatcaacgcca
tag

DBGET integrated database retrieval system