KEGG   Sinorhizobium meliloti 1021: SM_b20019Help
Entry
SM_b20019         CDS       T00058                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00020  Citrate cycle (TCA cycle)
sme00310  Lysine degradation
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
sme01200  Carbon metabolism
Module
sme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SM_b20019 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SM_b20019 (sucB)
Enzymes [BR:sme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SM_b20019 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 BDV_G GCV_H
Motif
Other DBs
NCBI-GeneID: 1236435
NCBI-ProteinID: NP_436562
RhizoBase: SM_b20019
UniProt: Q92XE0
Position
pSymB:complement(26206..27342)
Genome map
AA seq 378 aa AA seqDB search
MGGFIDIQAPLEQEGTKAVVRNWLRKIGDPVKSGDPLVELETDKVTQEVSAPADGVLAEI
LMRNGDDATPGAVLGRIGSEAAGAGHAPHYSPAVRHAAEEYGLDPATVTGTGRGGRVTRA
DMDRAFTARQEGPASVAAEAGDRGAAPKSRRIPHSGMRAAIAEHMLNSVTTAPHVTAVFE
ADFSAVMRHRDEHGKRLAADGTKLSYTAYVVSACVAAMRAVPEVNSRWHEDALETFDDIN
IGVGISLGDKGLVVPVIHRAQDLSLAEIAARLQDLTTRARSNALSRADVTGGTFTISNHG
ASGSLLAAPIIINQPQSAILGVGKLDKRVIVREVDGADTIQIRPMAYVSLTIDHRALDGH
QTNAWLTHFVRVIETWPK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcttcatcgacatccaggctccgctggagcaggaggggaccaaagcggtcgtc
cgcaattggctcaggaagatcggcgatccggtcaaatcgggcgatcccctggtcgagctc
gagaccgacaaggtgacccaggaggtgtcggcgcccgccgacggggtgctcgcggaaatc
ctgatgcggaatggcgacgatgccacgcccggcgccgttctcggccggatcggcagcgag
gctgccggggcgggacacgcgccgcactactcgccggccgtacggcatgccgcggaagaa
tatggcctcgatccggccaccgtcaccggcaccggccgcggtggccgcgtcacgcgcgcc
gacatggacagggcgtttaccgcccggcaggaaggccctgcttcggtcgcggccgaggct
ggcgacagaggagccgcacccaagtcgcgcaggataccgcatagcggcatgcgcgccgcg
atcgccgaacatatgctcaactccgtcacgacggcgccgcatgtgacggccgtgttcgag
gccgatttctcggcggtgatgcgccatcgggacgagcatgggaagaggcttgccgcggac
ggcaccaagctctcctatacggcctatgtggtttcagcctgcgtggcggcgatgcgcgcg
gtccccgaggtcaacagccgctggcacgaggatgcgctcgaaacattcgacgacatcaat
atcggcgtaggtatttcccttggggacaagggcctggtcgtgccggtgatccatcgggcg
caggatttgtcgcttgccgagattgcggcccggctgcaggacctgacgacgcgtgcgcgc
tcgaacgcgctctcccgcgcggacgtgacgggcggcaccttcaccatttccaatcatgga
gcctccggatcgctgctcgcggcgccgatcatcatcaaccagccgcaatcggcgatcctc
ggcgtgggcaagctcgacaagcgggtgatcgtccgcgaggtggacggcgccgacacgatc
cagatccgtccgatggcctatgtgtcgctgacgatcgaccatcgtgcgctggacggccac
cagacgaatgcgtggctgacgcatttcgtccgcgtgatcgagacctggccgaagtaa

DBGET integrated database retrieval system