KEGG   Sinorhizobium meliloti 1021: SM_b20099Help
Entry
SM_b20099         CDS       T00058                                 

Definition
maltose alpha-D-glucosyltransferase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sme00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:107125..108759
Genome map
AA seq 544 aa AA seqDB search
MKEAPWFSSSVIYGIDVRRFSDGNGDGIGDFIGLKERVSYLHYLGIDCVWLSPFFRSPFA
DNGYDVSDYYSIDPVLGTLDDFLDFLHAAGEQGIRVVVDLVANHTSSEHPWFQAARRDAR
CRFRDYYVWSESPPPVAPDNKTAFPGEESSVWTYDDLAQAYYFHKFRHFQPDLNIANPAV
RDELLRVVDYWLTLGVDGFRVDAAPFVIGETGIEHADPRDPQGFLREMRKLVDGRRQDGL
LLGEADLAPEKLRSYFGDGKLDLLFNFVLCAAFAASLAGQKADPIGQALSIMPEPPPHRG
WANFLRNLDELNLDRLPEDIREETFAAFAPDEEMRIYGRGIRRRLAPMLDGNRARIELAF
SLLLSSPGVPLILYGDEIGLGEDLSRPGREPVRVPMQWNAGSNAGFSTAQRAKLVQPPVT
DGPFSFKRVNVEAQREDPGSLLNRVRAMILARRRHELFNRGRPVMLHTGDPALFALAYSD
GTELFVVLHNLSDGKRRAELELPGAIDARLNDILGEGEVELSGQRLAIGLGPFGYVWLHS
GKKD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggcgccgtggttctcgagctcggtcatctatggaatcgacgtgcgcagattt
tcggacggaaatggcgacgggatcggcgacttcataggtctcaaggagcgcgtgtcttat
ctgcactatctgggcatcgactgtgtctggctctcgccgttcttcaggtccccctttgcc
gataacggctacgacgtcagcgactattattccatcgatccggttctcggaacgctggac
gacttcctggatttcctgcacgccgccggcgaacagggcattcgcgtcgtcgtcgatctc
gtcgccaaccacacatccagcgagcatccgtggttccaggcggcgcggcgcgacgcgagg
tgccgcttccgcgactattacgtctggtcggaaagcccgccgccggtcgctccggacaac
aagacggcgtttcccggcgaggaaagcagtgtctggacctatgacgatctcgcccaggcc
tattacttccacaagttccgccatttccagccggacctgaacatcgccaacccggcggtg
cgagacgaattgcttcgtgtagtcgactattggctgacattgggcgtcgacggattccgg
gtggatgccgcgccattcgtaatcggcgaaaccggcatagagcacgcggaccccagggac
ccccagggctttctcagggaaatgcgcaagctggtcgacgggaggcgccaggacggcctt
ctgctcggcgaagcggacctggcgccggaaaagctgcggtcctatttcggcgacggaaag
ctcgaccttctgttcaacttcgtgttgtgtgcggctttcgccgcgagcctcgcggggcag
aaggccgaccccatcggccaggcgctttcgatcatgccggagccgcctccccatcgcggc
tgggcgaacttccttcgcaatctcgacgaactgaacctcgatcgcctgccggaagacatt
cgagaggaaacctttgcagccttcgccccggatgaggagatgcggatctacggacgcggc
atcaggcgccgcctcgcgccgatgctggacggaaaccgggcgagaatagaactcgccttc
agtctgcttctgtcttccccgggcgtgccgctcattctctacggcgacgagatcggcctt
ggcgaggacctttcccgaccggggcgggagccggtccgcgtgcccatgcagtggaatgcg
ggttccaatgccggcttctccaccgcccagcgcgccaaactcgtccagccgccggtgaca
gacggcccattctccttcaagcgggtcaatgtcgaagctcaacgtgaggacccggggtcg
cttctgaaccgcgtgcgggcgatgatcctggcgcggcgccggcacgagctcttcaacagg
ggacgcccggtcatgctgcacaccggagacccggcgctgttcgcgctggcctattccgac
ggcaccgaactattcgtggtgctgcacaatctttcggacggcaagcggcgggcggagctc
gaactgcccggcgcaatcgacgccaggctcaatgacattctcggcgagggtgaggtcgag
ctttccgggcagcgtctggcgatagggctcggtccgttcggctacgtctggcttcattcg
ggaaagaaggattga

DBGET integrated database retrieval system