KEGG   Sinorhizobium meliloti 1021: SM_b20172Help
Entry
SM_b20172         CDS       T00058                                 

Definition
cytochrome c protein
Orthology
K08738  
cytochrome c
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SM_b20172
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SM_b20172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:190386..190796
Genome map
AA seq 136 aa AA seqDB search
MAFRLGTLLTAFVLFGGTLGAAAPALALDPSVGDPGAGEKVFRKCQACHAVGPDAKSKTG
PLLNGIIGRSAGKAEGYAYSPAMSKAAEAGLTWTPEKIAEFLTSPKGFLPGTKMTFAGLR
KDQERADIIAYLATFP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcttttagacttggtaccctgctgaccgctttcgtcctgttcggtggaactcttggc
gctgctgcgccggctcttgccctggatccctcggtcggagatcccggggcaggcgagaaa
gtcttccgcaagtgtcaggcctgtcacgccgtcggtccggatgccaaatcgaagaccgga
cccttgctgaacgggataatcggccggtcggccggcaaagccgaaggctacgcctactcg
ccggcgatgagcaaggcggccgaggcagggcttacctggacgccggagaagatcgctgag
tttctgacgagtccgaagggcttcctacccggcaccaagatgacctttgcgggtctgcgc
aaggatcaggagcgcgccgatataatcgcgtatctggcaacctttccctga

DBGET integrated database retrieval system