KEGG   Sinorhizobium meliloti 1021: SM_b20172Help
Entry
SM_b20172         CDS       T00058                                 

Definition
(RefSeq) cytochrome c protein
  KO
K08738  cytochrome c
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sme00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SM_b20172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 1236503
NCBI-ProteinID: NP_436712
RhizoBase: SM_b20172
UniProt: Q92WZ0
Position
pSymB:190386..190796
Genome map
AA seq 136 aa AA seqDB search
MAFRLGTLLTAFVLFGGTLGAAAPALALDPSVGDPGAGEKVFRKCQACHAVGPDAKSKTG
PLLNGIIGRSAGKAEGYAYSPAMSKAAEAGLTWTPEKIAEFLTSPKGFLPGTKMTFAGLR
KDQERADIIAYLATFP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcttttagacttggtaccctgctgaccgctttcgtcctgttcggtggaactcttggc
gctgctgcgccggctcttgccctggatccctcggtcggagatcccggggcaggcgagaaa
gtcttccgcaagtgtcaggcctgtcacgccgtcggtccggatgccaaatcgaagaccgga
cccttgctgaacgggataatcggccggtcggccggcaaagccgaaggctacgcctactcg
ccggcgatgagcaaggcggccgaggcagggcttacctggacgccggagaagatcgctgag
tttctgacgagtccgaagggcttcctacccggcaccaagatgacctttgcgggtctgcgc
aaggatcaggagcgcgccgatataatcgcgtatctggcaacctttccctga

DBGET integrated database retrieval system