KEGG   Sinorhizobium meliloti 1021: SM_b20327Help
Entry
SM_b20327         CDS       T00058                                 

Gene name
thuG
Definition
(RefSeq) trehalosemaltose transporter permease
  KO
K10238  
trehalose/maltose transport system permease protein
Organism
sme  Sinorhizobium meliloti 1021
Pathway
ABC transporters
Module
Trehalose/maltose transport system
Brite
KEGG Orthology (KO) [BR:sme00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SM_b20327 (thuG)
Transporters [BR:sme02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Trehalose/maltose transporter [MD:M00204] [OT]
    SM_b20327 (thuG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:330443..331273
Genome map
AA seq 276 aa AA seqDB search
MVVAIAKRTAFYALVAVIILVAVFPFYYAILTSLKSGTALFRIDYWPTDISLANYAGIFS
HGTFVRNLGNSLLVATLVVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVL
AGLFELIRFVGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPIEIEEAAIVDGASPWVV
ITRVFMPLMWPALVTTGLLAFIAAWNEFLFALTFTSSNTQRTVPVAIALLSGGSQFEIPW
GNIMAASVIVTVPLVVLVLIFQRRIISGLTAGGVKG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcgcgatcgcaaagcggacggcgttttatgcgctggttgccgtcatcatcctc
gtcgccgtctttcccttctattacgcgatcctgacgagcctgaagtccggcacggcactg
ttccgcatcgactactggccgacggatatttcgctcgccaattatgcaggcatcttttcg
cacgggaccttcgtgcgcaatctcggcaattcgctcctcgtcgccacgctcgtggttgcc
atatcgctgcttcttgccgtaaccgcagcctatgcgcttgcccgggtacgcttccgcggt
cgcgggctgcttctcctgacgatcctgtcggtctcgatgttcccgcagatcgccgttctt
gcaggtctcttcgagctcatccgcttcgtcgggatcttcaacacgccgctcgcgctcatc
ttttcctacatgatcttcacgctgccgttcacggtctgggtgctgaccaccttcatgcgg
gatctgccgatcgagatcgaagaagcggcgatcgtcgacggcgcttctccctgggtggtg
atcactcgtgtcttcatgccgctgatgtggccggcgcttgtgacaaccgggcttctcgcc
ttcatcgcggcgtggaacgagttcctcttcgcactgacattcacctcgtcgaacacgcag
cgcaccgtgccggtcgcgatcgctctgctttcaggcggcagccagttcgagatcccctgg
ggcaacatcatggcggcatccgtgatcgtcaccgtgcctctcgtggtcctcgtgctcatc
tttcagcggcggatcatttccggtctcacggccggcggcgtcaaaggatag

DBGET integrated database retrieval system