KEGG   Sinorhizobium meliloti 1021: SM_b20490Help
Entry
SM_b20490         CDS       T00058                                 

Gene name
fucA2
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SM_b20490 (fucA2)
Enzymes [BR:sme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SM_b20490 (fucA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:506812..507510
Genome map
AA seq 232 aa AA seqDB search
MAETETDKLALRREMVDICRRMNLSGINQGTAGNLSVRTDDGFLITPSSMPYDTMQPDDL
VEMGFDGTYVGHRPSSEWRFHRDILRARTDIDVVLHCHSIYATTLACHHKTIPSFHYMTG
IAGGTTIRCAEYATFGTQALSDNALLALKDRLACLLGQHGQISLGKTLEQALWLAIEVET
LSRIYVQALTLGEPPILPDDEMERVIAQMRRMSYGQAPDPEGVNDVARPRVS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggctgagactgagacggacaagctggcactccggcgggaaatggtggacatctgccgg
cggatgaatttgagcggcatcaaccagggcacggccggcaatctttccgtccgcaccgat
gacggcttcctcatcacgccgtcctccatgccctatgacacgatgcagccggacgacctg
gtggaaatgggcttcgatggcacctatgtgggccatcgaccctcatcggagtggcgcttc
catcgcgacattctgcgcgcgcgcacggatatcgacgtggtcctgcattgccactcgatc
tacgcgacgacacttgcctgccatcacaagaccattccgagctttcactacatgacgggg
attgccggcggcacgacgatccgctgcgccgaatatgcgaccttcggcacgcaggccctg
tcggacaacgcgctcctcgcgcttaaagaccgccttgcatgcctgctcgggcagcacggc
cagatatcgctcggcaaaacgctggaacaggcattgtggcttgcgatcgaggtagagacg
ctgtcgcggatctatgtccaggccctgacgctcggcgagccgcccatactgccggacgac
gaaatggagcgggtgatcgcccagatgcggcgcatgagctacggccaggcgccggacccg
gagggagtgaacgacgtggcgcgcccgcgcgtgtcgtga

DBGET integrated database retrieval system