KEGG   Sinorhizobium meliloti 1021: SM_b20514Help
Entry
SM_b20514         CDS       T00058                                 

Definition
protein-glutamate methyltransferase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sme02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sme02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:complement(536420..537637)
Genome map
AA seq 405 aa AA seqDB search
MATIIRIRHDPLISADISAPIVPAGKIFPSRLRFSRDRTYPFVERFCPMEHTMGRRDVIA
IGGSLGAVAALKHLLGKLPGDFAAAVFVVIHVGARGKDLLAEILNAHSGIPVTTAVDGEA
VERRHVYVAPADHHLLVIDGVIRLGRGPRENLARPAVDPLFRSVGLNYGPRAVAIVLTGM
LNDGAAGLADLKRCGGVTVVQNPSDAVAPDMPMGALRASDVDYRAPLEDLAALLVELTGE
EAGPPILVPAEIRLEVDIALGLQIGSETMLTIANPVPISCPACGGVLSQIKSWPPLRFRC
QVGHAYTSEALAAASEGAVDEALRVALRIIEERVTLSEKMAQDAHRSGFAAAAAANRRRA
NEGREHAETLRRAIIGSGTDATAGELEDADLAVAKHPDTIDPESS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtggccactattatacgcatccggcacgatcctcttatatcagctgacatatcggcgccg
atagtgccggctgggaaaatcttcccttcccgactaagattctcacgcgatcgaacttat
ccgttcgtcgaacgtttttgcccgatggagcatactatgggccgccgagacgtcatagcc
ataggaggttcgcttggcgcggtggcagccctgaagcacttgcttggcaaacttccgggc
gacttcgccgctgctgtgttcgtggtcatacatgtaggcgcacgcggaaaagatctactc
gccgagatactcaacgcccattccggaattcctgtaacgactgcagttgacggtgaggct
gttgagcgccggcacgtctatgttgcgccggcagaccaccacctcctcgtcattgacggc
gtcatccggcttggccgcggcccccgcgagaacctggcccgaccggcggttgaccctctc
tttcgatcagtcggcttgaattacggaccgcgggcagtcgcgatcgtactcacggggatg
ttgaacgacggggccgctggccttgccgatctcaaacggtgcggtggggtgacagtcgtc
cagaacccgagcgacgcagttgcgccggacatgccaatgggcgccctgagggcaagcgat
gtcgattaccgcgcgcctctcgaagatctcgctgcactcctcgttgagctcaccggcgaa
gaggccggtccgccaattctcgtccccgccgaaatcagacttgaggttgatatcgcgctt
ggcctacagatcggttccgagacaatgctaaccattgcgaacccggtcccgatctcgtgt
ccggcctgcggcggcgtactctcgcagatcaagagttggccgccgctgcggtttcgttgt
caagtcgggcatgcctatacgtccgaggctttggctgcggcgtcggaaggcgccgtcgac
gaggctctgagagttgcccttcgcatcatcgaggaaagagtgactctcagcgaaaaaatg
gcgcaagatgcgcatcgaagcggattcgccgccgccgccgccgcaaacagaaggcgggcc
aatgaaggacgggagcatgcggaaacattgcgccgcgccatcattggcagcgggacggac
gcaactgcaggcgaattggaggatgccgatctcgccgtcgctaagcatccggacacaatc
gacccggaatcatcttga

DBGET integrated database retrieval system