KEGG   Sinorhizobium meliloti 1021: SM_b20514Help
Entry
SM_b20514         CDS       T00058                                 

Definition
protein-glutamate methyltransferase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sme00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SM_b20514
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SM_b20514
Enzymes [BR:sme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SM_b20514
Two-component system [BR:sme02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SM_b20514
Bacterial motility proteins [BR:sme02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SM_b20514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:complement(536420..537637)
Genome map
AA seq 405 aa AA seqDB search
MATIIRIRHDPLISADISAPIVPAGKIFPSRLRFSRDRTYPFVERFCPMEHTMGRRDVIA
IGGSLGAVAALKHLLGKLPGDFAAAVFVVIHVGARGKDLLAEILNAHSGIPVTTAVDGEA
VERRHVYVAPADHHLLVIDGVIRLGRGPRENLARPAVDPLFRSVGLNYGPRAVAIVLTGM
LNDGAAGLADLKRCGGVTVVQNPSDAVAPDMPMGALRASDVDYRAPLEDLAALLVELTGE
EAGPPILVPAEIRLEVDIALGLQIGSETMLTIANPVPISCPACGGVLSQIKSWPPLRFRC
QVGHAYTSEALAAASEGAVDEALRVALRIIEERVTLSEKMAQDAHRSGFAAAAAANRRRA
NEGREHAETLRRAIIGSGTDATAGELEDADLAVAKHPDTIDPESS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtggccactattatacgcatccggcacgatcctcttatatcagctgacatatcggcgccg
atagtgccggctgggaaaatcttcccttcccgactaagattctcacgcgatcgaacttat
ccgttcgtcgaacgtttttgcccgatggagcatactatgggccgccgagacgtcatagcc
ataggaggttcgcttggcgcggtggcagccctgaagcacttgcttggcaaacttccgggc
gacttcgccgctgctgtgttcgtggtcatacatgtaggcgcacgcggaaaagatctactc
gccgagatactcaacgcccattccggaattcctgtaacgactgcagttgacggtgaggct
gttgagcgccggcacgtctatgttgcgccggcagaccaccacctcctcgtcattgacggc
gtcatccggcttggccgcggcccccgcgagaacctggcccgaccggcggttgaccctctc
tttcgatcagtcggcttgaattacggaccgcgggcagtcgcgatcgtactcacggggatg
ttgaacgacggggccgctggccttgccgatctcaaacggtgcggtggggtgacagtcgtc
cagaacccgagcgacgcagttgcgccggacatgccaatgggcgccctgagggcaagcgat
gtcgattaccgcgcgcctctcgaagatctcgctgcactcctcgttgagctcaccggcgaa
gaggccggtccgccaattctcgtccccgccgaaatcagacttgaggttgatatcgcgctt
ggcctacagatcggttccgagacaatgctaaccattgcgaacccggtcccgatctcgtgt
ccggcctgcggcggcgtactctcgcagatcaagagttggccgccgctgcggtttcgttgt
caagtcgggcatgcctatacgtccgaggctttggctgcggcgtcggaaggcgccgtcgac
gaggctctgagagttgcccttcgcatcatcgaggaaagagtgactctcagcgaaaaaatg
gcgcaagatgcgcatcgaagcggattcgccgccgccgccgccgcaaacagaaggcgggcc
aatgaaggacgggagcatgcggaaacattgcgccgcgccatcattggcagcgggacggac
gcaactgcaggcgaattggaggatgccgatctcgccgtcgctaagcatccggacacaatc
gacccggaatcatcttga

DBGET integrated database retrieval system