KEGG   Sinorhizobium meliloti 1021: SM_b20515Help
Entry
SM_b20515         CDS       T00058                                 

Definition
chemotaxis methyltransferase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sme00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SM_b20515
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SM_b20515
Enzymes [BR:sme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     SM_b20515
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SM_b20515
Two-component system [BR:sme02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SM_b20515
Bacterial motility proteins [BR:sme02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SM_b20515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:537727..541212
Genome map
AA seq 1161 aa AA seqDB search
MDRELDPPIVAIGASAGGVQALQTFFDLMPSDTGATFVVIVHLDPHARSELANILAARTR
MPVTQVEDQARLESNHVYVIAPNRRLKVADGTIAALPFEEPHALRAPIDLFFRSLAEEHG
SEFAVILTGAGADGAIGVKAVKEAGGIVLVQDPEEAEYASMPRNAIDTEVADFVLPIREL
PHRVAELLARRDQLPSHPFRADDDDMIGRILAHVRGRTGHDFSQYKRATILRRIGRRAQI
ARRETFADYYNYLRENPEEAQALFSDFLISVTTFFRDPSAFEALAERVIPQLFDGKEVAD
AIRVWIPGCATGEETYTMGMLLIEEAARRDLSPEIQVFGSDLDEQALRIAREGRYPSTIE
SDLSEERLRRFFQREGDHYRVRRELRDVVLFASHSLLRDPPFSHLDMISCRNLLIYLDRQ
LQQQVCNTFHYALNAGGFLFLGSSESADHPGLFLTVDREARIYRAVAGGGARRPMVLPAL
LGPQKPEMKSTIIRTPAAGHVSDAAVHRQMLEKIAPPSMLVDESHHAIHLSENAGRFLRP
SGGPVSTDATDLVREEFRFDVRAALHRAFERDEPTLSMPILADLDGQPHRVYLQVKPVVQ
GTERTRHALVLFIEGEAIDKTQEVVLDTLDGRPTIDEAIRRLQEELQLAQNRLRLTSEES
ATATEELRAANEELQSMNEEYRSTAEELETSKEELQSINEELQTVNNELKLKLESISRAH
SDLQNLMAATDIATLFLDPSLRIKRFTPRLTEIFNVTPSDEGRPITDFTHYLKYKRLSDD
ARAVLETLRPLEHEVKSRNDGWYLVRMRPYRTVEDKIDGVVVTFLDISERRHAEEAAKES
GRRLEQEMRLVELSRSPIFVWDFDDGIMQWNRGSEELYGYSREEAIGRRKEELLKTAVPG
SSFDRLRRTLSEKGRWSGELNHTTKDGRVLTVESQIELVPFGERRLVLESTRDITDRKRW
ERRGQLLLNELSHRVKNTLAVVQSLARQTLRTTRSSEDFVERFEGRLAALASAHKLLVDS
EWRGAELDALARGQLDAYAGSDRRRLQIEGEPVTLPPDLATPFGLVLHELATNAAKYGAF
STGNGQIRLSWKLGNNGRRLGVIWQERGGPPVEPPSEQGFGGVLIEKSLPGSTVHRDFQP
DGVVCTIDIELPEIRPDGAEN
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atggatcgagaattggatcctccgatcgtcgcaatcggagcctctgcgggtggcgtccag
gctcttcaaaccttctttgatcttatgcccagtgacacgggcgccaccttcgtcgtcatt
gtccatctcgatccgcacgccagaagcgagcttgcgaacattttggcggcacggacgcgc
atgccggttacacaggtcgaggaccaagcgcgccttgaaagcaaccacgtatacgtcatc
gcgccgaaccgtcggcttaaggttgctgatggtacgatagccgcgctccccttcgaagag
ccgcatgccctccgcgcacccattgatcttttctttcggtcgcttgccgaagagcatggc
agcgaatttgcggtcattctcactggtgccggggcggacggtgcgattggggtgaaggct
gtcaaggaggcgggcggaatcgtgctcgtccaggatcccgaggaggcggaatatgcctcc
atgccgcgcaatgccatcgacactgaggttgccgacttcgtgctgcctatacgcgagctt
cctcaccgggtggctgagttgctcgcccggcgtgatcagcttccgtcccacccgttccgc
gcagacgatgacgatatgatcgggcgaattctggcccatgtgcgcggccgaaccggacac
gatttctcacaatacaagcgggctacgattttgcgccgtatcggacggcgagcgcaaatt
gccaggagggagacctttgcggactactacaactacctgcgtgagaatcctgaagaagcc
caggcgctgttcagcgactttttgatttcggttacaacgttctttcgcgatccgtcggcc
ttcgaggctcttgccgaaagagttatcccgcaattgtttgacggaaaggaagttgccgac
gcgatcagggtctggattccgggctgcgccaccggtgaggaaacctatacgatgggcatg
cttctgatcgaggaggcggcacggcgcgacctttcgccggaaatccaggtcttcggctcg
gacctcgacgaacaggcactgcgcatcgcgcgcgaaggacgatacccatcgactatcgaa
agcgatctctcggaggaacgactgcgccggttctttcagcgtgagggagatcactatcgg
gtgcgccgcgagttgcgcgatgtggtgctctttgccagccacagcttgctcagagacccg
cccttctcccatctcgatatgatttcctgccgcaacctgctgatctacctcgatcggcag
ctgcagcagcaggtgtgcaacacgtttcattacgcgctcaacgcaggtggcttcctcttc
ctcggatcgtcggaaagtgccgaccaccccgggctcttcctcactgtggatcgcgaggca
cgtatctacagggctgtcgcgggcggcggtgctcgacgaccaatggtgctgccggcgctg
cttggtccacaaaagccggaaatgaaatcgaccatcattcggacaccagcggcagggcac
gtcagcgacgcagcggtacaccgccagatgctggagaaaatcgctcctccaagcatgctg
gtcgatgaaagtcaccacgcgattcatctttcggaaaatgccggacgctttctccgaccc
tcaggtggccccgtcagtaccgacgcgacggatctcgtgcgcgaggaatttcgcttcgat
gtaagagcggcgctgcaccgggccttcgagagggatgaacccactttgagcatgcccatc
cttgctgaccttgatgggcaaccgcaccgcgtctacctgcaagtgaagccggtggtccag
ggaacggaacgcacccggcatgcccttgtgctttttatcgaaggcgaggcaatcgacaag
acccaggaggtagtgctcgatactcttgacgggcgcccgacgatcgacgaggcgatccgc
cgcttgcaggaggagctgcaactcgcgcaaaaccgtcttcgactgaccagtgaggagtcg
gccaccgccaccgaggaactgcgggctgccaacgaagaactacagtcgatgaacgaggaa
taccgttcgacggccgaggaactggaaacgagcaaggaagagctccaatcgatcaatgag
gagctgcaaaccgtcaacaatgagctcaaactgaagctggaaagcatatcgcgggctcac
agcgacttgcagaacttgatggccgcgaccgacatcgcgacgctttttctcgacccgtcc
cttcgtatcaagcgttttaccccgcggctgacggagatattcaacgtcacgccgagcgac
gaaggtcggccgatcactgatttcacgcattatcttaaatataagagactttctgatgac
gcacgcgcggtgctggagacgctcaggccactcgagcacgaggtgaagagccgcaatgac
ggatggtatctggtgcggatgcgcccctaccgcacagtggaagacaagatagacggcgtt
gtggtgaccttcctcgacatcagcgagcggcgccatgccgaagaggcggcgaaggagagc
gggcgacgccttgagcaggaaatgcggctcgtcgagctttcgcgctcaccgatattcgta
tgggactttgacgatggcataatgcagtggaatcgcggcagcgaggaactctatggctat
tcgcgcgaggaggcgattggaaggcgcaaggaagaactgctaaagacggccgttcccggc
tcctcctttgacaggctcaggcgaacactcagcgaaaagggccgttggagcggcgaactg
aaccataccacgaaggacggtcgagtgctgacggtagagagccagatcgagctcgtgccg
tttggcgagcgccgccttgtgctggaaagcacccgcgacatcaccgaccgcaaacggtgg
gagcggcgcgggcagcttttgctaaacgagctaagccaccgcgtgaagaacacgctcgct
gtcgtccagtcgctggcgcgccagacgctccgcacaacccgatcgagcgaggacttcgtc
gaacgctttgaagggcgcctcgcagcacttgcgagtgcccataagctgcttgtcgattct
gaatggcgcggcgccgagcttgacgcattggcgcgagggcaacttgatgcctacgccggc
agcgatcggcgccgactgcagatcgagggcgaaccagtgacgctgccgccggacctcgct
acaccctttggtctcgtgctccacgagctcgcgaccaatgctgcgaaatacggcgcattt
tctactggaaacggacagatcaggctcagctggaaactcgggaacaacggccgaaggctt
ggggttatctggcaagaacgcggtggcccgccggtcgagccgccgagcgagcagggtttc
ggcggcgttctgatcgagaagagcttgccaggatctacggttcatcgcgatttccaaccg
gatggcgtcgtctgcacgatcgacatcgagcttccggagatccggccagatggcgcggaa
aactga

DBGET integrated database retrieval system