KEGG   Sinorhizobium meliloti 1021: SM_b20960Help
Entry
SM_b20960         CDS       T00058                                 

Gene name
exoN
Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SM_b20960 (exoN)
   00052 Galactose metabolism
    SM_b20960 (exoN)
   00500 Starch and sucrose metabolism
    SM_b20960 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    SM_b20960 (exoN)
Enzymes [BR:sme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SM_b20960 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:1187438..1188343
Genome map
AA seq 301 aa AA seqDB search
MDRVRTVRKAVIPVAGNGTRFLPATKAVPKEMLTIVDRPVVQYAVDEARQAGIEHIVFVT
SRNKQVIEDHFDDAPELISSLSRSGKSAQISELEAMLPAAGSVSFTRQQAPLGLGHAVWC
ARDLIGDEPFALLLPDMVSFGARGCVAGLMDLYHEVGGNVVGVEQCAPEEASKYGIVGKG
ETVRHGFSVTEMVEKPAAGKAPSNYYLNGRYILQPEIFSILAHQTRGAGNEIQLTDGMLT
LSQSQSFHAHPYEGRTFDCGSKQGFIEANVAFALARADIGDIVFESVRDMVLSHESRIRA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtgtcaggaccgtcagaaaagcagtaatcccggttgccggaaacggaacgagg
ttccttccggcgacgaaggcagtgcccaaggagatgttgacgatcgtcgaccggccagtc
gttcagtatgccgtggacgaggcccgccaggccggaatcgaacatatcgtcttcgtcacc
agccggaacaagcaggtgatcgaggaccatttcgacgacgcgccggagctcatctcgtcg
ctttcacgctccggcaaaagcgcgcagatttccgaactcgaggccatgttgccggcagcc
ggctcggtcagctttacccgtcagcaggcccccctcggcctcgggcacgcggtatggtgt
gcgcgtgacctgatcggcgacgagcccttcgcgcttctgctgccggacatggtctccttc
ggcgcgcgcggttgcgtggccggcctcatggacctctatcacgaggttggcggcaacgtc
gtcggcgtcgagcaatgcgcccccgaggaagcatcgaaatacggcatcgtcggcaagggc
gagacggtccggcacggtttctccgtaaccgagatggtcgaaaagcccgccgccggaaag
gcaccgtccaactactatctcaatggtcgctacatccttcagccggaaatcttctcgatt
ctggcccatcagacacgcggcgccggcaatgagatccagttgaccgatggcatgctgacg
ctttcgcaatcccagtccttccacgcgcatccctatgaaggccgcaccttcgactgcggc
tcgaagcagggcttcatcgaagccaatgtcgccttcgcccttgctcgtgcggacatcggc
gatatcgttttcgaatccgtccgcgacatggttctgtctcacgaaagccgcatccgggcg
gcataa

DBGET integrated database retrieval system