KEGG   Sinorhizobium meliloti 1021: SM_b20966Help
Entry
SM_b20966         CDS       T00058                                 

Gene name
lacZ2
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SM_b20966 (lacZ2)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SM_b20966 (lacZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:complement(1194246..1196186)
Genome map
AA seq 646 aa AA seqDB search
MCYYPEQWPRGKWAEDARRMVELGLSWVRIGEFAWAKIEPRSGEFHWEWLDEAIDVLGKA
GLKVILGTPTAAPPKWLVNRYPEILPVDATGAVRKFGARRHYCFSSRRYRSEAARITEAM
ARRYGEHIYVHAWQTDNEYGDHDTIYSYSAEAVGAFRLWLAERYGSIDELNRAWGTSFWS
MRYDSFEEIDLPNNLVEEPSPTHGVDFIRFSSDQVKSFNKAQVDIIRAHSPGRPVTHNFM
SQNTDFDHYRVGEDIDIASWDVYPMGGLLNGRLAAKDKEHYLRVGDPDQPAFNHDLYRAV
GRGRVWVMEQQPGPVNWAAHNQSPADGMVRLWTWLAYAHGVDMVSYFRWRQAPFAQEQFH
AGLLLPNSEADQGYLEVAEVVAEMKRLPEGEVRGKAQVAIVLDYESRWATRVLPQGRSYS
ASAVALDWYSTVARLGVDVDFIGQHSDIAGYKLILAPDLVIAEEAFVERLTRADAKVVFG
ARSGSKTRDMHIPEGLPPGPLAKLIDISVSRVESLPEFHSETVLYGNEAYEAGGWRETVR
TSETVIASFDGEYRNGAPALVGSDKARYLAVAANGALLDKVIGDALGWAGLESLPDLGDL
RVTRRGNLRFAFNFGRIPAEVPAGASAEFYVGGRTLKPVDVAIWRE
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
gtgtgctactacccggaacaatggccgcgcgggaaatgggcggaggacgcccggcgaatg
gtcgagctcggcctctcctgggttcgcatcggtgagttcgcctgggcgaaaatagagccg
cggtcgggcgaatttcattgggaatggctggacgaggcgatcgatgttctgggcaaggcc
ggcctcaaggtcatcctcggcacgccgacggcggccccgccgaaatggctcgtgaaccgc
tatcccgagattctgccggtggacgcgaccggagcggtgcgcaaattcggcgcgcgacgc
cactattgcttctcgagccggcgttatcgctccgaggcggcgcgcatcaccgaggcgatg
gcgcgccgctatggcgaacacatctatgtccatgcctggcagacggacaatgaatatggc
gaccacgacacgatctacagctattccgccgaggcggtcggggcgttccgcttgtggctg
gccgaacgctacggctcgatcgatgagctgaaccgcgcctggggcacctcattttggtcg
atgcgctacgatagcttcgaggaaatcgacctgccgaacaatctcgtggaggagccgagc
cccacccacggggtggatttcattcgcttctcttccgatcaggtgaagagcttcaacaag
gcgcaggtcgacatcatccgggcgcattcgcccgggcgaccggtgacgcacaacttcatg
tcgcagaacaccgatttcgatcattacagggtgggcgaggacatcgacatcgcctcctgg
gacgtctatccgatgggcggcctgctcaacggacgcctcgcagcgaaggacaaggagcat
tatctccgggtcggggatcccgaccagccggccttcaaccacgatctctaccgcgccgtc
ggccgcggccgcgtctgggtcatggagcagcagccggggccggtgaactgggcggcgcac
aaccagtcccccgccgacggcatggtgcggctctggacgtggctcgcctatgcccatggg
gtcgacatggtctcctatttccgctggcggcaggcgcctttcgcgcaggaacagtttcac
gcgggcctccttcttccaaacagcgaggcggatcagggctatcttgaagtcgccgaagtc
gtcgctgaaatgaagcgcctgcccgagggagaggtgcgtggcaaggcgcaggtcgcgatt
gttctcgactacgaatcgcgctgggccacacgcgtcttgccgcaggggcggagctattcc
gcttcggcggttgcgctcgactggtattcgacggtggcccgcctcggcgtcgatgtggat
ttcataggacagcactccgatatcgccggatacaagctgatccttgccccggatctcgtg
atcgccgaggaggccttcgtcgagcggctcacgcgagcggatgccaaggtggtcttcggc
gcgcgcagcggcagcaagacgagggacatgcacatccccgagggactaccaccaggaccg
ctggcgaagctcatcgatatcagcgtctcgcgggtcgagtcgctgccggagtttcacagc
gagactgttctctatggcaacgaggcctatgaggcgggcggttggcgcgagacggtcagg
acgagcgaaactgtcatcgcaagcttcgacggggagtatcgtaacggcgcgccggcgctc
gtcggcagcgacaaggcacgctacctggcggttgcggccaacggcgcattgctcgacaag
gtgatcggcgacgcgctcggctgggctgggttggaaagcctgcccgacctcggcgatctt
cgcgtgacgcgccgtggcaatctccgtttcgccttcaatttcggccggatccccgcggag
gttcccgcgggcgcctcggccgagttctacgtgggaggccgcacgctaaaacccgtcgat
gttgcgatctggagggaatga

DBGET integrated database retrieval system