KEGG   Sinorhizobium meliloti 1021: SM_b21009Help
Entry
SM_b21009         CDS       T00058                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sme00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
pSymB:complement(1242315..1243808)
Genome map
AA seq 497 aa AA seqDB search
MGGYILAIDQGTTSTRAIVFDGNQKIAGVGQKEFKQHFPKSGWVEHDPEEIWQTVVSTVK
EAIEKSGITANDIAAIGITNQRETVVVWDRETGKPIHNAIVWQDRRTAAFCDKLKKKGLE
KTFVKKTGLLLDPYFSGTKLNWLLSNVKGAQVRAAKGELCFGTIDTFLIWRLTGGECFCT
DATNASRTLLYNIAENAWDDELTEVLRVPKEMLPEVKDCAADFGVTDPSLFGAAIPILGV
AGDQQAATIGQACFKPGMLKSTYGTGCFALLNTGKDMVRSKNRLLTTIAYRLDGETTYAL
EGSIFVAGAAVQWLRDGLKVIKAAPDTGSLAESADPSQEVYLVPAFTGLGAPHWDPDARG
AIFGMTRNTGPAEFARAALEAVCYQTRDLLEAMHKDWRRNGNDTVLRVDGGMVASDWTMQ
RLSDLLDAPVDRPVILETTALGVAWLAGSRAGVWPNQEAFAKSWARDRRFEPHMDEATRK
VKLKGWRSAVKRTLIAA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggcggatatattctcgcgatcgatcagggcacgacgtccacgcgcgcgatcgttttc
gacggcaaccagaaaatcgcgggcgtcgggcagaaagagttcaagcagcactttccgaag
tcaggctgggtggagcacgatccggaggagatctggcagacggtcgtcagcacggtcaag
gaagcgatcgagaagtccggcatcaccgcgaacgatattgccgcgatcggcatcaccaac
cagcgggagacggttgtcgtctgggatcgcgagaccggcaagccgatccacaatgccatc
gtctggcaggaccgccgcactgccgccttctgcgacaagctcaagaagaagggactggaa
aagaccttcgtgaagaagaccggtctgctgctcgatccctatttttcgggaacgaagctc
aactggctgctttccaatgtgaagggcgcgcaggtgcgcgcagccaaaggcgaactctgc
ttcggcactatcgacaccttcctgatctggcggttgacgggcggcgagtgcttctgcacc
gacgcgacgaatgcctcgcgtaccctcttatacaatatcgccgagaatgcctgggacgac
gagctcaccgaggtcctgcgcgtgccgaaggagatgctgccggaagtgaaggactgcgcg
gccgacttcggcgtcacggatccgtctctcttcggcgcggcgatcccgatcctcggcgtt
gccggcgaccagcaggcggcaacgatcggtcaggcctgtttcaagccgggcatgctgaaa
tcgacctacggtacgggctgcttcgccttgctcaacaccggcaaggacatggtccgctcg
aagaaccgccttctgaccaccatcgcctaccgcctcgacggtgaaacgacctatgcgctc
gaaggctcgatcttcgtagccggtgctgccgtgcaatggctgcgcgacgggctcaaggtg
atcaaggcggcgcccgatacgggctcgcttgccgagagcgccgatccctcgcaggaggtc
tatctggtgccggccttcaccggcctcggagcgccccattgggatccggatgcgcggggc
gcgatcttcggcatgacgcgcaataccggcccggcagagttcgcacgggcggcactcgag
gccgtctgctaccagacccgcgacctgctcgaggccatgcacaaggattggcgccgcaac
ggcaatgatacggtcctgcgcgtcgatggcggcatggtcgcctccgactggacgatgcag
cgcctgtcggacctgctcgacgctccggtcgaccgcccggtcattctcgaaaccaccgcg
ctcggcgtcgcctggcttgcaggcagccgcgccggcgtctggccaaaccaggaggcgttc
gccaagtcctgggcccgcgaccgccgcttcgagccgcatatggacgaggccacgcgcaag
gtgaagctcaagggctggcgcagcgcagtcaagcggacgttgattgctgcctga

DBGET integrated database retrieval system