KEGG   Sinorhizobium meliloti 1021: SM_b21010Help
Entry
SM_b21010         CDS       T00058                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sme00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sme00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
pSymB:1244108..1244884
Genome map
AA seq 258 aa AA seqDB search
MTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGAPDEIRTVTDEVAGLSSGTVLHHPA
DMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTI
RGAIPPMKKKGWGRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNS
ICPGYVLTPLVEKQIPDQARTRGITEEQVINEVMLKGQPTKKFITVEQVASLALYLAGDD
AAQITGTHVSMDGGWTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagactgcggtgataacgggttccacgagcggcatcggattggcgatcgcccgg
accctggcgaaggccggtgccaatatcgtcctgaacggcttcggtgcgccggacgagatc
aggaccgtcacggatgaagtcgcaggcctgagctccggtacggtgcttcatcacccggcc
gacatgaccaagccctccgaaatcgccgacatgatggcgatggttgccgatcgcttcggc
ggcgccgatatcctcgtcaacaatgccggcgtgcagttcgttgaaaagatcgaggatttt
ccggtcgagcaatgggaccggatcatcgccgtcaatctctcctcctcctttcacaccatt
cgtggcgccattccgccgatgaagaagaagggctggggccggatcatcaatatcgcgtcc
gctcatggcctcgtggcctcccccttcaagtccgcctatgtcgccgccaagcatggtatc
atggggttgacgaagactgtggcgctggaggtggcggagagcggtgtcaccgtgaactcg
atctgccccggctacgttctgacgccgctcgtcgaaaagcagataccggatcaggcgaga
acgcgcggcatcaccgaggaacaggtgatcaacgaggtgatgctcaagggacagccgacg
aaaaagttcatcaccgtcgaacaggttgcctccctggcgctctatcttgcaggcgacgat
gccgcccagatcaccgggacgcatgtttcgatggatggcggctggacggcgcagtag

DBGET integrated database retrieval system