KEGG   Sinorhizobium meliloti 1021: SM_b21283Help
Entry
SM_b21283         CDS       T00058                                 

Definition
(RefSeq) allantoicase (EC:3.5.3.4)
  KO
K01477  
allantoicase [EC:3.5.3.4]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SM_b21283
Enzymes [BR:sme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.4  allantoicase
     SM_b21283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:complement(857872..858894)
Genome map
AA seq 340 aa AA seqDB search
MTRAGEVLPGFAGGTINLASAGLGARALFATDEFFGPLERMLKDEPAAFHPGLYDDHGKW
MDGWETRRRRGAGHDYAVIALAAKGRIAGFDVDTSHFTGNYPSACSIEACHSAEDPDEAT
EWVQLLPVTGLGPNAHHFFAAHSDAVYSHIRLRIHPDGGIARLRVYGTPALDLKAMANET
IDLASCLLGGRIVAFSNGHYGHERLIAPGRGANMGDGWETRRRREPGYDWIIVKLAARGH
VERILVDTAHFKGNYPDACSLQAADLGGMTAECDMLVASSAMFWNELLPHRKLSADSVHE
YGSDMLRHADPVTHVRLNIYPDGGVSRLRIYGRVADPRSR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtgccggcgaagtcctgcccggctttgcgggcgggacaatcaacctcgcttcc
gcaggccttggcgcccgggcgctctttgcgacggacgaattcttcggcccgctggagcgt
atgctaaaggacgaaccggccgcattccaccccggcctttacgacgatcacggcaaatgg
atggacggctgggaaacccgccgccgccgcggcgccggccacgactacgcggttatcgcg
ctcgccgcgaaagggcggattgccggcttcgacgtcgacacgtcgcacttcaccggcaat
tatccgagcgcctgctcgatagaagcctgtcattcggcggaagatccggacgaggcgacc
gagtgggtccaactgctgccggtcaccggcctcggaccgaatgcacatcacttcttcgcc
gcgcactccgacgcggtctacagccatatccggctgcgcatccatccggatggaggtatc
gcccggcttcgggtctacggcactccggcactcgatctcaaggctatggcgaacgagacg
atcgatcttgcgtcctgcctgctcggcggtcggatcgtcgccttctccaacggccattac
ggccacgagcgcctcattgccccagggcggggcgcgaatatgggcgacggctgggaaacg
cgcaggcggcgcgaaccgggctacgactggatcatcgtcaagcttgccgcacgcgggcac
gtcgaacggatcctcgtcgataccgcgcatttcaaaggcaactatccggatgcttgctcg
ctacaggcggctgacctcgggggcatgactgccgagtgcgacatgctcgttgcctcctcc
gcgatgttctggaacgagcttctgccgcaccggaagctttcggccgacagcgtccatgag
tatgggtccgatatgctcagacatgccgatccggtcacgcatgtgcgcctgaacatctac
ccggatggcggcgtcagccggctgcgcatttacggccgggtcgctgaccccagatcacga
tga

DBGET integrated database retrieval system