KEGG   Sinorhizobium meliloti 1021: SM_b21284Help
Entry
SM_b21284         CDS       T00058                                 

Definition
(RefSeq) uricase
  KO
K00365  urate oxidase [EC:1.7.3.3]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00230  Purine metabolism
sme01100  Metabolic pathways
sme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SM_b21284
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    SM_b21284
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     SM_b21284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OHCU_decarbox Polysacc_deac_1
Motif
Other DBs
NCBI-GeneID: 1237119
NCBI-ProteinID: NP_437328
RhizoBase: SM_b21284
UniProt: Q92VC0
Position
pSymB:complement(858904..860319)
Genome map
AA seq 471 aa AA seqDB search
MRYPRDLLGHGPNPRIAWPDGARIAVQFVINYEEGGENCVLHGDAASEAFLSEIVGAQAW
PAQRHWNMESIYEYGARAGFWRLHRLFTDRQIPATVYGVATALKRSPAQVAAMQDAGWEI
ASHGLKWIEHKDFDAERERAEIAEAIRLHTIVTGERPTGWYTGRCSVNTLDLVTEAGGFD
YVSDAYADDLPYWHEHAGRHQLVIPYTLDANDMRFATPQGFNSGDQFFSYLKDSFDVLYA
EGTAGAPKMMSIGLHCRLVGRPGRAAALARFLDYVQSHEKVWLARRIDIARYWAETYPFQ
PNEDRPSRLSKDAFIDRFGGVFEHSDWIARRAFAGELGPANDTATGLHAALCAVFREASE
EERLAVLTAHPDLAGKLAQAKRLTESSTSEQASAGLDALTDQERERFTTLNNAYVEKFGF
PFILAVKGRSKDEILAAFENRIGNDRETEFVTACRQVERIALLRLRDTLPD
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagatatccccgcgatctcctgggccatggtccgaacccgcgtatcgcctggcccgat
ggcgcccggatcgccgttcaattcgtgatcaattacgaggagggcggagagaactgcgtg
cttcacggcgacgcggcgtccgaggccttcctctcggaaatcgtcggcgctcaggcctgg
cccgcccagcgccactggaacatggaatcgatctacgaatacggggcgcgcgccggattc
tggcggctgcaccggttgttcaccgaccggcaaataccggccaccgtctacggcgtcgcc
acggccctcaagcgatcgcccgcccaggtggccgccatgcaggacgccggctgggagatc
gcctcccacggcctcaaatggatcgagcacaaggatttcgacgccgagcgcgaacgcgcc
gagatcgccgaggcgatccgcctccacaccatcgtaaccggagaacggccgaccggctgg
tacaccggccgctgctccgtgaacacgctcgatctcgtgaccgaggccggcggcttcgac
tacgtctccgacgcctatgcggacgacctgccctattggcatgaacatgccggccggcac
cagctcgtcatcccctataccctcgacgccaacgacatgcgcttcgcaacgccacagggc
ttcaacagcggcgaccagttcttcagctatctgaaggacagtttcgacgttctctacgcc
gagggaactgccggcgcgccgaagatgatgagcatcggccttcactgccgtctcgtcggc
cggcccggccgcgccgccgcactggcccgcttcctcgactatgtgcagagccacgagaag
gtctggctcgcccgccgcatcgacattgcccgttactgggcagagacctatccgttccag
ccgaacgaagaccgtccctcgcggctttcgaaggatgccttcatcgatcgcttcggaggg
gtattcgagcactcggactggatcgccagacgcgcctttgcaggcgaactcggcccggcc
aacgatacggcgacgggactgcacgcggcgctctgcgcggtctttcgcgaggcaagcgaa
gaggaacggcttgccgtcctcaccgcccaccccgatcttgccggcaagctcgcccaggcg
aaacgcctgaccgagagctcgacttcggaacaagcctcggcgggcctcgacgcactgacg
gatcaggagcgcgagcgtttcacgaccctcaacaatgcctatgtcgagaagttcggcttc
cccttcatcctggccgtcaaggggcgcagcaaggacgagatccttgccgccttcgagaac
cgtatcggcaacgatcgggagacggaattcgtcaccgcgtgccgccaggtggagcggatc
gcgctcctgcggctgcgcgacacgctgccggactga

DBGET integrated database retrieval system