KEGG   Sinorhizobium meliloti 1021: SM_b21284Help
Entry
SM_b21284         CDS       T00058                                 

Definition
uricase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sme00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:complement(858904..860319)
Genome map
AA seq 471 aa AA seqDB search
MRYPRDLLGHGPNPRIAWPDGARIAVQFVINYEEGGENCVLHGDAASEAFLSEIVGAQAW
PAQRHWNMESIYEYGARAGFWRLHRLFTDRQIPATVYGVATALKRSPAQVAAMQDAGWEI
ASHGLKWIEHKDFDAERERAEIAEAIRLHTIVTGERPTGWYTGRCSVNTLDLVTEAGGFD
YVSDAYADDLPYWHEHAGRHQLVIPYTLDANDMRFATPQGFNSGDQFFSYLKDSFDVLYA
EGTAGAPKMMSIGLHCRLVGRPGRAAALARFLDYVQSHEKVWLARRIDIARYWAETYPFQ
PNEDRPSRLSKDAFIDRFGGVFEHSDWIARRAFAGELGPANDTATGLHAALCAVFREASE
EERLAVLTAHPDLAGKLAQAKRLTESSTSEQASAGLDALTDQERERFTTLNNAYVEKFGF
PFILAVKGRSKDEILAAFENRIGNDRETEFVTACRQVERIALLRLRDTLPD
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagatatccccgcgatctcctgggccatggtccgaacccgcgtatcgcctggcccgat
ggcgcccggatcgccgttcaattcgtgatcaattacgaggagggcggagagaactgcgtg
cttcacggcgacgcggcgtccgaggccttcctctcggaaatcgtcggcgctcaggcctgg
cccgcccagcgccactggaacatggaatcgatctacgaatacggggcgcgcgccggattc
tggcggctgcaccggttgttcaccgaccggcaaataccggccaccgtctacggcgtcgcc
acggccctcaagcgatcgcccgcccaggtggccgccatgcaggacgccggctgggagatc
gcctcccacggcctcaaatggatcgagcacaaggatttcgacgccgagcgcgaacgcgcc
gagatcgccgaggcgatccgcctccacaccatcgtaaccggagaacggccgaccggctgg
tacaccggccgctgctccgtgaacacgctcgatctcgtgaccgaggccggcggcttcgac
tacgtctccgacgcctatgcggacgacctgccctattggcatgaacatgccggccggcac
cagctcgtcatcccctataccctcgacgccaacgacatgcgcttcgcaacgccacagggc
ttcaacagcggcgaccagttcttcagctatctgaaggacagtttcgacgttctctacgcc
gagggaactgccggcgcgccgaagatgatgagcatcggccttcactgccgtctcgtcggc
cggcccggccgcgccgccgcactggcccgcttcctcgactatgtgcagagccacgagaag
gtctggctcgcccgccgcatcgacattgcccgttactgggcagagacctatccgttccag
ccgaacgaagaccgtccctcgcggctttcgaaggatgccttcatcgatcgcttcggaggg
gtattcgagcactcggactggatcgccagacgcgcctttgcaggcgaactcggcccggcc
aacgatacggcgacgggactgcacgcggcgctctgcgcggtctttcgcgaggcaagcgaa
gaggaacggcttgccgtcctcaccgcccaccccgatcttgccggcaagctcgcccaggcg
aaacgcctgaccgagagctcgacttcggaacaagcctcggcgggcctcgacgcactgacg
gatcaggagcgcgagcgtttcacgaccctcaacaatgcctatgtcgagaagttcggcttc
cccttcatcctggccgtcaaggggcgcagcaaggacgagatccttgccgccttcgagaac
cgtatcggcaacgatcgggagacggaattcgtcaccgcgtgccgccaggtggagcggatc
gcgctcctgcggctgcgcgacacgctgccggactga

DBGET integrated database retrieval system