KEGG   Sinorhizobium meliloti 1021: SM_b21600Help
Entry
SM_b21600         CDS       T00058                                 

Gene name
ampC
Definition
beta-lactamase (EC:3.5.2.6)
Orthology
K01467  
beta-lactamase class C [EC:3.5.2.6]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
beta-Lactam resistance
Biosynthesis of secondary metabolites
Two-component system
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:sme00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SM_b21600 (ampC)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SM_b21600 (ampC)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     SM_b21600 (ampC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:complement(1140561..1141751)
Genome map
AA seq 396 aa AA seqDB search
MTHFSATKFVMAAAALLCCGAGAHAADRGEEGELARLVDETIRPLMREHGVPGMAIAVTV
RGKKYIFNYGLASRESGQKVTDETMFEIGSVSKTFTAMLASYAEARGDLTLSDPAGKYLP
ALAGTRFDDISLLNLGTYTAGGLPLQFPDSVTDQESMIDYYRDWRPTYAAGTHRLYSNPS
IGLFGYLAAKSMGEPFADLMEKSIFPAFGLTSTFIAVPQDRADDYAYGYSKAGKPIRVTR
GVLDSEAYGVKTTAADLIRFVEANIDGTGLDEPIRRAIAATHTGYFKVGAMTQGLGWEMY
PYPTKLDDLLAGNSSRMALEPHKVSKLVPPAAPQENLWINKTGSTNGFGAYAAFVPAERI
GIVMLANRNYPIPARVKAAYQILSTLESGPGSADAR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacatttttccgcgacgaaattcgtaatggctgcggctgctttgctctgctgcgga
gccggcgcgcacgccgccgaccgaggcgaggaaggagagcttgcacgcttagtggacgag
acgatccggccgctgatgagggagcatggcgttccgggaatggcgatcgcggtcaccgtc
cgcggaaagaagtacatcttcaactatggcctggcgtcgagagagagcgggcagaaggtc
accgacgaaacgatgttcgagatcggctcggtcagcaagaccttcacggcgatgctcgca
tcctatgccgaagcgcgtggggatctgaccctatccgatcctgccggcaaatatctgccc
gcgctcgccgggacccgttttgacgacatcagccttctcaatctcgggacctataccgcc
ggcggactgccattgcagtttcccgattccgttaccgatcaggagagcatgatcgactac
tacagagattggcgcccgacctatgccgccgggacgcacaggctttactcgaacccgagc
atcggcctcttcggctatctagccgcaaagagcatgggcgagcctttcgccgatctgatg
gagaagagcatattcccggcattcggcctgacgagcaccttcatagccgttccgcaggat
cgggcggacgactatgcctatggttattcgaaagccggcaagccgatccgcgtcacgcgc
ggcgttctcgactcggaagcctacggcgtaaagacgaccgctgccgatctgatccgcttc
gttgaggcaaacatcgatggaacgggcctggacgagccgatccggcgcgcgatcgccgca
acgcacaccggatacttcaaggtcggggccatgacgcaggggctcggctgggagatgtat
ccctatccgacgaagctcgacgatctgcttgccggcaattccagccggatggcgctcgag
ccgcacaaggtcagcaagctcgttccgcccgcggcgccccaggaaaacctgtggatcaac
aagaccggctcgaccaacggtttcggcgcctatgcagccttcgtcccggccgagcgcatc
ggcatcgtgatgctggcgaacaggaattacccgattcctgcccgcgtgaaagccgcatac
cagatactgtcgacgctcgagagcggccccggatcggcggacgcccgctga

DBGET integrated database retrieval system