KEGG   Sinorhizobium meliloti 1021: SM_b21655Help
Entry
SM_b21655         CDS       T00058                                 

Gene name
lacZ1
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SM_b21655 (lacZ1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    SM_b21655 (lacZ1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SM_b21655 (lacZ1)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SM_b21655 (lacZ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymB:3086..5353
Genome map
AA seq 755 aa AA seqDB search
MMRSVTSFNDSWVFSEGFDAADAGTLRAGQPISLPHNAVELPFNYFDERCYQRAFTYQRV
LAWRPDFSGREVSLVFDAAMADAVVYLNGEEIVAHRDGYTPFEARLTDRLLEGDNLITVK
IDGSENPEIPPFGGRIDYLTYAGIYRDVWLKVTDPVSIANIKIETRDVLSDTKAVSLRCD
LSNPQGLSFSGTISALLKNAAGEVLAEVAGETTGQSLAFEMDGLKGLSLWDIDDPVLYVI
EVELRTGQGSDCFAAHFGFRTAEFTTEGFRLNGRPLKIRGLNRHQSFPYVGYAMGRTAQE
RDADIMKHRLHCNLVRTSHYPQSKWFLDHCDRIGLLVFEEIPGWQHIGGEEWKQEAIRNV
RRMIERDWNHPSIVIWGVRINESQDSHDFYAETNRLARELDPTRQTGGVRYITDSEFLED
VYTMNDFILGNEELPGANRPRTALRPQQECTGLPRKVPYLITEFGGHMYPTKIYDQEQRQ
AEHVRRHLEVLNAAYGDPGISGAIGWCMFDYNTHKDFGSGDRICYHGVMDMFREPKFAAY
VYASQCDPSEEIVMKPVTFWARGERNIGGVLPLIVLTNCDEIELKYGSLTKRVGPDRENF
PHLPHPPVVIDHRHFTKDELGVWGMKWESAEFTGFIAGKPVADLRMAADPVPTTLQVEAD
SKTLRAEGRDSVRLILRALDQAGNVQPFLNDAVDIEIHGPARLVGPARIVLQGGSAGFWL
ESTGAAGAIVVSVASSRLGAAKLDLVALADGAASA
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgctctgttacttccttcaatgattcatgggtcttctccgaaggcttcgacgcc
gccgacgccggaacgctccgggcgggtcagccgatcagcctgccgcacaatgccgtcgaa
ctgccgttcaactatttcgacgagagatgctaccagcgcgccttcacctaccagagggtt
cttgcctggcgcccggacttctccgggcgcgaggtctcgctcgtcttcgacgcggcaatg
gccgatgcggtcgtgtatctcaacggcgaagagatcgtcgcgcatagggacggctacacg
cctttcgaggcgcgcctgacggacaggctcctggaaggcgacaatctcatcacggtgaag
atcgacggcagcgaaaatccggagatcccgcctttcggcggccggatcgactatctgacc
tatgccggtatctatcgcgacgtctggctgaaggtcaccgatccggtttcgatcgccaat
atcaagatcgaaacccgcgacgtgctctccgacaccaaggccgtctccctccggtgtgac
ctttccaatccgcaagggctatccttctccggcacgatctcggcgctcctcaagaatgcg
gccggcgaagtgctggccgaggtcgccggcgagacgaccggccagagcctcgcctttgaa
atggacggcctcaagggcctttccctttgggatatcgatgatccggtgctctacgtgatc
gaagtcgagctcaggaccggtcagggctccgactgcttcgccgcgcatttcggcttccgc
acggcggagttcacgaccgagggcttccggctcaatggccgcccgctgaagatccgcggg
ctgaaccgtcaccagtcttttccctatgtcggctacgctatggggcgcaccgcccaggag
cgcgacgctgacatcatgaagcacaggcttcactgcaatctcgtgcgcacctcgcattac
ccgcagtcgaaatggttcctcgaccattgcgaccgcatcgggctcctcgtcttcgaagaa
atccccggctggcagcatatcggtggggaggaatggaaacaggaggcaatccggaacgtc
cgccgcatgatcgagcgcgactggaaccacccgtcgatcgtcatctggggtgtgcgcatc
aacgagtcgcaggattcgcacgacttctatgccgagaccaatcgcctcgcccgcgagctc
gacccgacacggcagacgggcggcgtgcgctacatcaccgacagcgaatttttggaagac
gtctacacgatgaacgacttcatcctcggcaacgaggaactgccgggcgcgaaccggccg
cgcacggcgcttcgcccgcagcaggaatgcaccgggcttccccgcaaggtgccctatctc
atcaccgaattcggcggccacatgtatccgacgaagatctatgaccaggagcagcgccag
gccgagcatgttcgccggcatctggaggtgctgaatgcggcctatggcgatcccggcatc
tccggtgcgatcggctggtgcatgttcgactacaacacccacaaggatttcggctccggc
gaccggatctgctatcacggcgtcatggacatgttccgcgagccgaaattcgcggcctat
gtctatgccagccagtgcgatccctccgaggaaatcgtgatgaagccggtgaccttctgg
gcgcgcggtgagcgcaacatcggcggcgtgctgcccttgatcgtgctgacgaattgcgac
gagatcgaattgaaatacggctcgctgaccaagcgcgtcggcccggatcgcgagaatttc
ccgcacctgccgcatccaccggtcgtcatcgaccaccgccacttcaccaaggacgagctc
ggagtctggggcatgaagtgggagagcgcggaatttaccggcttcatcgccggcaagccg
gtcgccgatctccgcatggccgccgaccccgtacctacgacgcttcaggtcgaggcggac
agcaagacgctccgtgccgaaggccgcgacagcgttcgcctcatcctgcgcgcgctcgac
caggccggcaacgtccagcctttcctgaacgatgcggtcgacatcgagattcatggtccg
gcgcgcctcgtcggaccggcccgcatagtcctccagggcggttccgccggtttctggctg
gagtccacgggcgccgccggcgccatcgtcgtctcggtcgcgtcgtcgcggctcggcgcg
gcgaagctcgacctcgtcgccctggcggacggagcggcgagcgcatga

DBGET integrated database retrieval system