KEGG   Sinorhizobium meliloti 1021: SMa0398Help
Entry
SMa0398           CDS       T00058                                 

Gene name
hisD2
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sme01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sme00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymA:215421..216791
Genome map
AA seq 456 aa AA seqDB search
MTLRPQLARYKDKTMTSVSFYEYSKLNAEEKAALLRRSETDISGFIEKVAPILEAVRTEG
DKALARFGRELDKADVTEANLKVTAAEFDAAFKLVDASVLESVQFGIDNIRKFHEEQKPE
AMWLKEIRPGAFAGDRFTPIQSVALYVPRGKGSFPSVTMMTSVPAVVAGVPNLAIVTPPA
PDGSVDAATLVAARLAGVETVYKAGGAQAVAAVAYGTETVKPALKIVGPGSPWVVAAKRS
LSGVIDTGLPAGPSEVMILADDTVHGGLAALDLLIEAEHGPDSSAYLVTHSGRVAEEALA
ALPEHWARMTEQRTAFSKTVLSGKTGGIVLTSSIEESYEFVNAYAPEHLELLSEQPFIHL
GHITEASEILMGTHTPVSIANFSLGPNAVLPTSRWARTFGPLSVTDFVKRSSIGYVTAPA
YPEFARHSHNLAIYEGFSSHALAVSPVRDAYLKKGA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacccttcggccccaactggccagatacaaggacaagacgatgacatcagtgtctttc
tacgaatattcgaagctgaacgccgaagagaaggccgccttgctgcgccgttcggaaacc
gacatatcgggcttcatcgaaaaggtcgcgccgatcctcgaagcggtccgcaccgagggc
gacaaggcactggcacgcttcggccgcgaactcgacaaggccgatgtaacggaagccaat
ctcaaggttacggcggcagagttcgatgcggccttcaagctggttgatgcaagtgtcctc
gagtccgttcaattcggcatcgacaacatccgcaaattccatgaggagcagaagccagaa
gccatgtggctgaaggagatccgccccggcgcttttgccggagaccgcttcacgcccatt
cagtcggtcgcgctctacgtcccacggggcaagggctccttcccgtcggtgactatgatg
acatcggtcccggccgtggttgcaggcgtcccgaacctggccattgtcacgccgccggcg
ccggacggttcggtcgatgccgcgacgctggttgctgcacgtctcgccggcgttgaaacc
gtctacaaggcgggcggcgcgcaggccgttgctgctgtcgcctatggcaccgaaacggtc
aagccggcgctgaagatcgtcggtcccggcagcccttgggtggtcgccgccaagcgctcg
ctctccggcgtcatcgataccgggcttcccgctggtccgtccgaggtgatgatcctcgcc
gacgacacggtccatggtggccttgccgcgctcgacctgctgatcgaggccgaacatggc
ccggattcttccgcttacctcgttacccacagcggccgcgtcgccgaggaggcgctcgca
gccctgccagaacactgggcgaggatgaccgaacagcgcaccgccttctcaaagaccgtg
ctgagcggaaagacggggggcatcgtcctcacttcgtcgattgaggaaagctacgagttt
gtcaacgcctatgcgccggagcatctggagctcctgtcggaacagcccttcattcatctg
ggccacatcaccgaagcttccgaaatcctgatgggcacccatactccggtcagcatcgcc
aatttctcgctcgggcccaacgccgtattgccaaccagccgctgggcccgcaccttcggc
ccgctgtcggtcaccgatttcgtcaaacgcagttcgatcggctatgtcacggcaccggcc
tatccggaattcgccaggcattcccacaatctggcgatctacgagggcttctcctcgcat
gcgcttgccgtatcgccggtgcgcgacgcctatctgaagaagggcgcctga

DBGET integrated database retrieval system