KEGG   Sinorhizobium meliloti 1021: SMa0875Help
Entry
SMa0875           CDS       T00058                                 

Gene name
nolG
Definition
(RefSeq) NolG efflux transporter
  KO
K03296  
hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family
Organism
sme  Sinorhizobium meliloti 1021
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymA:complement(485661..488858)
Genome map
AA seq 1065 aa AA seqDB search
MFLTRISINHPVFATMMMVMILVLGLFSYGRLGVDHYPETDLPVVVVATTYTGASPESVE
SEISRPIEAALNTIGGIDTITSESYEGRSIVVVQFEVDVDSQDAAQEVRDRVARLETKFP
DGVATPQVTRYKPEGQAILSVAVSSTSRTLPEITTLATRVINNRLSVISGVGQVSLIGSS
ERQVLVVVDPDRLGAYGLAVSTVIEAIRGENQDRAAGTLISGINQRIVTVEGRIANTSGF
NRIIVAQRNGYPVYLSEVATILDTGAEVTSLANYQGQTTLGLHIVKVQGANTVEVASAVR
REVSALNAELTKDNVQLTITRDNSRPIASQVSQVQRTLVEGGVLSVLIVFIFLNSWRSTV
ITGLTLPISVIGTFAAIYALGFTLNIMTLMALSLSIGILIDDAIVVRENITRHLQMGKDP
VRAALDGTNEIGLAVLSTTLCIVAVFLPVAFMGGLIGRFFLQFGVTVAVAVVISLFVSFT
LDPMLSSVWCDPQSQKTAKRGFFGQLIERFDQWFEGLASRYRSVIYFTFDYRKTTIAIVL
GMFVVSLLLVPRIGTEFLPPPDQGEVSISLEANEGASLDYMAAKVGQIERALREFNYVSS
TYSTINSGEMRGFNKALVAVQLVHSSQRRLKTAETLGPIRRRLSRIAGLEISVGQRSEVV
GSIKPLQLSILGDGDEELRRISDHITSVLAAIPGATEIESSIEKLRPTLAVRVRREAASD
LGVSIATIGDTLRSLVAGDAISVWNSPDGETHDVVVRLPAAGRENAAQLRNLPIATARMD
DNGKPIMVLLDQVADVVESTAPAQITRKDLSRDIRISSNIEGRTLGDVVADLKAAMTKMD
IPVGFRISFGGDAENLTESTAYALQSLAMAVIFIYIILASQFGSFIQPIAIIMTMPLSLM
GVLLGLLFTGSTLNMFSMIGIMMLMGLVTKNAILLVDYSNLGVREGKSLRQSLADAGAVR
LRPIVMTTLAMIFGMLPTALGLGEGGAQRAPMAHAIIGGLISSTLLSLVFVPVVLTYLDA
FAGRVRRWVPSPTGSNASAQHDGSDKTKTPACALTSQDQLGTTIM
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcacacgtatcagcatcaaccatccggtcttcgctaccatgatgatggtgatg
atccttgtccttggtctgttttcatatggtcgactcggtgtcgatcactaccccgagacc
gacctgccagtcgtagtggtcgcgaccacctacaccggagcatcgcccgaatcggtcgaa
agcgagatctcacggccgattgaggcggcgctcaacactatcggcggaatcgacaccatc
acctcggaatcctacgaagggcgttcgatcgtcgtggtgcagttcgaagtcgatgtcgat
tcacaggacgcggcacaggaggtgcgcgacagggttgcgcgtcttgaaactaagtttccc
gacggagtggcgacccctcaggtcacgcgatacaagccggaaggccaggcaatcctctct
gttgcagtgtcctcgacgagccggacgctgcccgaaatcaccacgcttgccactcgcgtg
atcaacaatcgcctgagcgttatatcgggcgtcggccaagtttcactgattggcagcagc
gagcggcaagttctcgttgttgtggaccctgatcgtctcggggcctacggcctcgctgtc
tccaccgtcatcgaagcaatccgaggcgaaaaccaggatcgggcggcgggaacgcttata
tccggcatcaatcagcgaatcgtaacggtcgagggacgcattgcgaatacttcaggcttc
aaccgcatcatcgtcgctcaaagaaacggctatcccgtctacctttcggaagtggcaacc
attctcgacacaggcgccgaagttaccagccttgcaaactaccaaggccagacaactctc
ggtttgcacatcgttaaggtccaaggcgccaacacggtcgaggttgcgtccgcagttcgc
agggaagtttccgcgctgaacgcagaactgacaaaggacaacgtccaactcaccatcaca
cgtgacaactcccgccccattgcctcccaggtttcccaagtacagcgaacgctggtcgaa
ggaggtgttctgtccgtgctgatcgtgttcatatttttgaactcctggcgatccacggtt
atcaccggccttactctccccatttcagttattggcacattcgcggcaatttacgctctc
ggcttcacgctgaacatcatgacgcttatggcactctccttgtccatcggcattctgatt
gacgatgcgatagtcgtacgtgaaaacatcactcgccatctacaaatgggcaaggatcct
gtaagggcggccctggatggaaccaacgagattggccttgcagtgctgtcgacaacactg
tgcatcgtcgctgtgtttctgccggttgccttcatgggcgggctgatcggtcgctttttc
cttcagtttggcgttaccgtagccgtggccgtggtcatttcgctctttgtgtcctttact
cttgatccgatgctgtcgagcgtttggtgcgatccccaatctcaaaaaactgccaagcga
ggtttcttcgggcaactgattgagcggttcgatcaatggttcgagggacttgcaagccgc
tatcgctcggttatctacttcacattcgactaccggaaaacgacaattgctattgtccta
ggcatgtttgtcgtcagcctgctgcttgttccgcgcatcggaactgagtttttgccgcca
cccgaccagggagaagtgagcatatcgctggaagccaacgaaggcgcttccctcgattac
atggccgcgaaagtcggtcagatcgaacgagcactgcgagaattcaattatgtctcctcg
acgtattcaactatcaattccggggaaatgcgtggcttcaacaaggccctggtggccgtg
caacttgtgcacagcagtcaaaggaggctgaagacggcggaaaccctcggtcctatccgc
cggcggctttccaggatcgccggcctcgaaatctcagtcggacagcgttcggaagtggtc
ggatcgataaagccgttacaattgtcgatcctcggggatggtgacgaggagttgcgacgg
atctccgatcacatcacctcggtgcttgcggccattccgggcgctacggagatcgaatct
tcaatcgaaaagcttcgaccaacgctggctgttcgggtacgccgcgaggcggcgagcgat
ctcggcgtgtcgatcgcaacgataggcgatacactcaggtcactagtcgcgggtgatgca
atatctgtatggaacagccctgacggagaaacccacgatgtcgtggtgcgcctccccgcc
gccggccgagagaacgccgcacagctccgtaatcttccaatcgccaccgctcgtatggac
gacaatggcaagccgataatggtcttactggatcaggtagccgatgtcgtcgagagcacc
gcgcctgctcagatcacccgcaaggatctgtcccgggacattcgcatatccagcaacatt
gaaggaaggacgttgggcgacgttgtggccgatctgaaggccgcgatgacaaagatggat
atcccagtggggtttcgaatttcattcggcggcgatgcggagaacctgaccgagagcacc
gcctatgcactccagtcgctggcgatggccgtcatcttcatctacattatcttggcttct
cagttcggctccttcatccagccaatcgccatcatcatgacaatgccgctatccttgatg
ggtgtcctgcttggccttctgtttacgggctccacactcaatatgttctcgatgatcggc
atcatgatgctgatgggtttggtgacaaagaacgcgatccttctggtcgactactccaat
ctaggcgttcgcgaaggcaaaagcctgcgtcagagccttgcagatgccggagcggtaaga
ctccggccgatcgtgatgacgaccctcgccatgattttcggtatgctcccaacagccctg
ggcttgggcgaaggcggcgcgcagcgcgcgccaatggcccatgcaatcatcggcgggttg
atatcctccaccctcctcagtttggtctttgtgcctgtcgtgctgacttatcttgatgcc
ttcgccgggcgcgtaaggcgctgggtgccttctcctactggatcgaatgcttcggctcag
cacgacgggtccgataagactaaaactcctgcttgcgctctcacaagccaggatcagtta
gggacaacaattatgtga

DBGET integrated database retrieval system