KEGG   Sinorhizobium meliloti 1021: SMa1487Help
Entry
SMa1487           CDS       T00058                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sme00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sme02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymA:complement(819484..819852)
Genome map
AA seq 122 aa AA seqDB search
MNKVVIAALVSLAVSGHATPALSQEAAPGQKLFQQRCGACHQLETPRNGVGPHLLGVVGR
TAGSVDGFRYSAALKGSGIAWTAETLETFLSNPAAMVRGTRMAQRFNNADERRAIIAFLR
AQ
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaggtcgtcattgctgcgctcgtttctcttgctgtttcaggccacgccacgccg
gctctgtctcaggaggctgcaccaggtcagaagctgtttcagcaacgctgcggtgcgtgc
catcagctcgagacacctcgaaacggcgtcggaccgcatctgctgggtgtcgtcggccga
acggccggcagcgttgacggcttcaggtattccgcggctcttaaaggttccggtatcgca
tggaccgccgaaacgctggaaaccttcctgagcaatcccgccgcgatggttcgcggaacg
cgcatggcccagcgtttcaacaacgccgacgagcgtcgagcgatcatcgcgttccttagg
gcgcaatag

DBGET integrated database retrieval system