KEGG   Sinorhizobium meliloti 1021: SMa1547Help
Entry
SMa1547           CDS       T00058                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sme  Sinorhizobium meliloti 1021
Brite
Enzymes [BR:sme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SMa1547 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymA:853409..854080
Genome map
AA seq 223 aa AA seqDB search
MKPMNEEHLAVLRRHMVEVVAIYADLASEELGKAALDERVMAAMLRVPRHLFVPAQAAPF
AYQDMPLPIGFDKTVSQPFMVALMTDLLAPKPHEAVLEIGTGLGYQTAILAQLAGKIWSV
EIIEEFASHAEALLHGLGMSNVGIRIGDGSRGWPEHAPFDKILVTAAAEEPPPALLEQLK
PMGRLVLPVGSEEQVLTVIDKDSEGQFLARQLIPVRFSKLEAV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatgaacgaagagcacctcgccgttctgcgcaggcacatggtcgaggtggtc
gcaatctatgccgaccttgcaagtgaagaactcggcaaggcggcgctcgatgaacgggta
atggcagcgatgctgcgggtaccgcggcatctgttcgtgcccgcccaggctgcgcccttt
gcctaccaggacatgccgcttccgatcggcttcgataaaaccgtgtcgcagcccttcatg
gtcgcactcatgaccgatctccttgctcccaaaccgcatgaggccgtgcttgagatcggc
accggcctgggctatcaaaccgcaatcctcgctcaactcgccgggaagatttggagcgtc
gagatcattgaggaattcgcaagccatgccgaggctctcctgcacggcctcggcatgtct
aatgtcggcattcgtatcggcgacggttcacgcggctggcctgagcacgctccattcgac
aagatcctggtcacggcggcggctgaggagccgcctccggctttgctcgagcagctcaag
ccaatgggccgccttgttcttcctgtgggttcggaagaacaggtgctgactgtcatcgac
aaggattcggaggggcaattcctggcgcggcaactcatcccggttcggttcagcaagctc
gaggcggtctaa

DBGET integrated database retrieval system