KEGG   Sinorhizobium meliloti 1021: SMa1561Help
Entry
SMa1561           CDS       T00058                                 

Gene name
cheB2
Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sme00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SMa1561 (cheB2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SMa1561 (cheB2)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SMa1561 (cheB2)
Two-component system [BR:sme02022]
 CheA family
  CheA-CheYBV
   SMa1561 (cheB2)
Bacterial motility proteins [BR:sme02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SMa1561 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pSymA:864232..865296
Genome map
AA seq 354 aa AA seqDB search
MVRILLATSTVELEDLVKRAIEGDASAELVLIARSGREAVRMTGELLPDIVAVELCPSGD
DSAETVREIMIAAPTPVVMLSHRDGSQLGTISARALEAGALAVIPAPAAHGMQLEQPAIE
KFLSTIKAMSQVKVVRQWRQKVRGDRAAKDQPPTARTPIGIVGIAASTGGPAAIRAILKD
ISADLPVPILIVQHMSNGFIDGVAASLNATVPLTVKVARNGELLKPGTVYLAPDNCQLGV
SGRSRLRVSDDAPVNGFKPSGSYLFGSIARAFKGESLAVVLTGMGDDGTEGLRALRMAGG
KAIAQDEKSSVVFGMPKSAIGAGLVDLVLPLESIAENITAIARGRSEPEGETRT
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggtacgcattcttctcgcgacatcgacagtcgagctcgaggatctcgtaaagagggct
atcgagggggacgcctcagcggagctcgtactgatcgcaagaagcgggagagaagccgtt
agaatgaccggcgaactcttgccggacattgtcgccgtggagctctgcccctccggggat
gacagcgcagaaacggtcagggagataatgatcgcggcaccgacaccggtcgtaatgctc
tcccatcgggacggctcgcagctcgggaccatatcggcgcgggcactcgaagcgggcgct
ctcgcggtcatcccggcgccggccgcgcacggcatgcagctcgaacaaccggccatcgaa
aagttcctctcaacgatcaaagccatgtcgcaggtaaaggtcgtccggcaatggcgccag
aaggtccgcggagatcgcgcggctaaagaccaaccgccaacggcaaggacgccgatcgga
atcgtgggaatcgcggcctcgaccggtgggccggcggcgatccgtgcgatactgaaagac
atctcagccgatctcccggtgccgatcctcatcgtccagcacatgtcgaacggcttcatc
gacggcgttgccgcctctctcaacgcgaccgtgccgctcacggtgaaggtcgccaggaat
ggagagcttctcaaacccggcacggtctacctagcgccggacaactgtcagctcggcgtc
tcgggcaggtcacgcctacgcgtctcggacgatgctcccgtcaacggcttcaaaccgtcc
ggatcctacctcttcggctcgatcgcgcgtgccttcaagggagagtccctcgcggtcgtc
ctgaccggaatgggcgatgacggaaccgaggggcttcgggcactgcgcatggcgggcggc
aaggcaatcgcgcaggatgagaagagctcggtcgtcttcggcatgccgaagtcggcgatc
ggtgccggtctcgtggacctggtgctgccgctggaaagcatagccgagaacatcactgcc
atcgcccgggggcggagcgaaccggaaggggaaacgaggacatga

DBGET integrated database retrieval system